BLASTX nr result
ID: Chrysanthemum21_contig00038715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00038715 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736077.1| disease resistance protein RPS2-like [Lactuc... 83 1e-15 gb|PLY72091.1| hypothetical protein LSAT_9X121401 [Lactuca sativa] 83 1e-15 >ref|XP_023736077.1| disease resistance protein RPS2-like [Lactuca sativa] Length = 988 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +2 Query: 290 LIQGKTALWDPLKRTIASSNDMDEIYGALDEAMNTLVAKKDDHDNMVQ 433 +IQGKTALW+PLK+TIA S DMDEIYGALD+AM TL+AK+DDH++MVQ Sbjct: 15 IIQGKTALWEPLKQTIALSKDMDEIYGALDDAMQTLIAKRDDHEDMVQ 62 >gb|PLY72091.1| hypothetical protein LSAT_9X121401 [Lactuca sativa] Length = 988 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +2 Query: 290 LIQGKTALWDPLKRTIASSNDMDEIYGALDEAMNTLVAKKDDHDNMVQ 433 +IQGKTALW+PLK+TIA S DMDEIYGALD+AM TL+AK+DDH++MVQ Sbjct: 15 IIQGKTALWEPLKQTIALSKDMDEIYGALDDAMQTLIAKRDDHEDMVQ 62