BLASTX nr result
ID: Chrysanthemum21_contig00038497
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00038497 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH89676.1| Peptidase C19, ubiquitin carboxyl-terminal hydrol... 95 3e-20 ref|XP_021969352.1| ubiquitin carboxyl-terminal hydrolase 20-lik... 65 6e-10 gb|KVH95199.1| Peptidase C19, ubiquitin carboxyl-terminal hydrol... 63 4e-09 ref|XP_022020685.1| ubiquitin carboxyl-terminal hydrolase 20-lik... 58 3e-07 >gb|KVH89676.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, partial [Cynara cardunculus var. scolymus] Length = 776 Score = 95.1 bits (235), Expect = 3e-20 Identities = 46/66 (69%), Positives = 56/66 (84%) Frame = +2 Query: 2 EVVFAPTPEQLKLVEKTACKRPRHKEVMNCPKTREAWKDCRKLPGARGALLMAALDASLK 181 EVVFAP EQLKLVE+T CKRPR+K+V++ REA K CRK+PGARG+LLMAALDASLK Sbjct: 698 EVVFAPKLEQLKLVERTLCKRPRNKDVVDDTAKREALKQCRKMPGARGSLLMAALDASLK 757 Query: 182 SQGMLH 199 ++G +H Sbjct: 758 NEGSVH 763 >ref|XP_021969352.1| ubiquitin carboxyl-terminal hydrolase 20-like [Helianthus annuus] gb|OTG22072.1| putative ubiquitin specific protease domain-containing protein [Helianthus annuus] Length = 645 Score = 65.5 bits (158), Expect = 6e-10 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = +2 Query: 2 EVVFAPTPEQLKLVEKTACKRPRHKEVMNCPKTREAWKDCRKLPGARGALLMAALDASLK 181 EVVFA P+Q K VEK CKRPR+ E + K REA + C+++PGARG LLMAAL A K Sbjct: 549 EVVFAAKPKQSKPVEKATCKRPRNNEAEDSAK-REAMRMCKRMPGARGDLLMAALSA--K 605 Query: 182 SQGML 196 S+ L Sbjct: 606 SENSL 610 >gb|KVH95199.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 [Cynara cardunculus var. scolymus] Length = 759 Score = 63.2 bits (152), Expect = 4e-09 Identities = 34/66 (51%), Positives = 46/66 (69%) Frame = +2 Query: 2 EVVFAPTPEQLKLVEKTACKRPRHKEVMNCPKTREAWKDCRKLPGARGALLMAALDASLK 181 EVVFAP +QLKLVEK + KR R K+V + K EA + C+++P ARG LLMAAL+ K Sbjct: 657 EVVFAPKADQLKLVEKPSYKRQRSKDVEDSVK-HEALRQCKRMPSARGNLLMAALEMGPK 715 Query: 182 SQGMLH 199 S+ ++ Sbjct: 716 SENSVN 721 >ref|XP_022020685.1| ubiquitin carboxyl-terminal hydrolase 20-like [Helianthus annuus] gb|OTF85096.1| putative ubiquitin specific protease domain-containing protein [Helianthus annuus] Length = 629 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = +2 Query: 5 VVFAPTPEQLKLVEKTACKRPRHKEVMNCPKTREAWKDCRKLPGARGALLMAALDA 172 VVFAP P+QLKL +K KR R EV K REA K CR++PG+RG LL++A+ + Sbjct: 561 VVFAPKPKQLKLAKKATSKRLRDNEVAGSAK-REALKICRRMPGSRGKLLISAMSS 615