BLASTX nr result
ID: Chrysanthemum21_contig00038341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00038341 (616 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020960251.1| uncharacterized protein LOC110262418 [Arachi... 61 8e-08 ref|XP_022035602.1| uncharacterized protein At5g41620 [Helianthu... 61 2e-07 ref|XP_016161816.1| uncharacterized protein LOC107604683 [Arachi... 61 3e-07 ref|XP_023763668.1| uncharacterized protein LOC111912171 [Lactuc... 60 4e-07 ref|XP_010059393.1| PREDICTED: uncharacterized protein At5g41620... 59 9e-07 gb|KCW90502.1| hypothetical protein EUGRSUZ_A02622 [Eucalyptus g... 59 9e-07 ref|XP_015970578.1| uncharacterized protein At5g41620 [Arachis d... 59 2e-06 ref|XP_004303519.1| PREDICTED: uncharacterized protein LOC101292... 58 2e-06 gb|KDO70546.1| hypothetical protein CISIN_1g011939mg [Citrus sin... 58 3e-06 dbj|GAY33016.1| hypothetical protein CUMW_005230 [Citrus unshiu]... 58 3e-06 ref|XP_006481709.1| PREDICTED: uncharacterized protein LOC102631... 58 3e-06 ref|XP_024188522.1| uncharacterized protein LOC112192853 [Rosa c... 58 3e-06 ref|XP_006430122.1| uncharacterized protein At5g41620 isoform X1... 58 3e-06 ref|XP_019425234.1| PREDICTED: uncharacterized protein At5g41620... 57 8e-06 gb|OIV92197.1| hypothetical protein TanjilG_31116 [Lupinus angus... 57 8e-06 >ref|XP_020960251.1| uncharacterized protein LOC110262418 [Arachis ipaensis] Length = 213 Score = 60.8 bits (146), Expect = 8e-08 Identities = 36/51 (70%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRI-SMSQKPPRL 3 E R RSGSLP LSDPSHS PVSERMD+SGTGS HRR S+ Q+PPRL Sbjct: 133 EKIARSMRSGSLPPHLSDPSHS-PVSERMDQSGTGSRHRRTPSVPQRPPRL 182 >ref|XP_022035602.1| uncharacterized protein At5g41620 [Helianthus annuus] gb|OTG29203.1| hypothetical protein HannXRQ_Chr04g0119651 [Helianthus annuus] Length = 589 Score = 61.2 bits (147), Expect = 2e-07 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = -3 Query: 170 TIRGAYEESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMSQKP 12 T RG E+++ + GSLP LSDPSHSP VSERMDRSGTGSHRRIS +P Sbjct: 116 TTRGR-EKTNRVVCTPGSLPPHLSDPSHSP-VSERMDRSGTGSHRRISSGHRP 166 >ref|XP_016161816.1| uncharacterized protein LOC107604683 [Arachis ipaensis] Length = 669 Score = 60.8 bits (146), Expect = 3e-07 Identities = 36/51 (70%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRI-SMSQKPPRL 3 E R RSGSLP LSDPSHS PVSERMD+SGTGS HRR S+ Q+PPRL Sbjct: 133 EKIARSMRSGSLPPHLSDPSHS-PVSERMDQSGTGSRHRRTPSVPQRPPRL 182 >ref|XP_023763668.1| uncharacterized protein LOC111912171 [Lactuca sativa] gb|PLY85588.1| hypothetical protein LSAT_2X54721 [Lactuca sativa] Length = 581 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 152 EESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMSQK 15 E+++ +H GSLP LSDPSHSP VSER+DRSGTGSH R S+S K Sbjct: 131 EKTNRPVHTPGSLPPHLSDPSHSP-VSERIDRSGTGSHHRTSISHK 175 >ref|XP_010059393.1| PREDICTED: uncharacterized protein At5g41620 [Eucalyptus grandis] Length = 654 Score = 59.3 bits (142), Expect = 9e-07 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -3 Query: 128 RSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMS 21 RSGSLP LSDPSHSP VSERMDRSGTGSHRR S S Sbjct: 134 RSGSLPPHLSDPSHSP-VSERMDRSGTGSHRRRSSS 168 >gb|KCW90502.1| hypothetical protein EUGRSUZ_A02622 [Eucalyptus grandis] Length = 656 Score = 59.3 bits (142), Expect = 9e-07 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -3 Query: 128 RSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMS 21 RSGSLP LSDPSHSP VSERMDRSGTGSHRR S S Sbjct: 134 RSGSLPPHLSDPSHSP-VSERMDRSGTGSHRRRSSS 168 >ref|XP_015970578.1| uncharacterized protein At5g41620 [Arachis duranensis] Length = 670 Score = 58.5 bits (140), Expect = 2e-06 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRI-SMSQKPPRL 3 E R RSGSLP LSDPSHS PVSERMD+S TGS HRR S+ Q+PPRL Sbjct: 133 EKIARSMRSGSLPPHLSDPSHS-PVSERMDQSATGSRHRRTPSVPQRPPRL 182 >ref|XP_004303519.1| PREDICTED: uncharacterized protein LOC101292227 [Fragaria vesca subsp. vesca] Length = 686 Score = 58.2 bits (139), Expect = 2e-06 Identities = 36/56 (64%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -3 Query: 167 IRGAYEESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRISMSQKPPRL 3 IR +E R RSGSLP LSDPSHS PVSERMDRSGTGS HRR S + RL Sbjct: 130 IRAREKERVARSLRSGSLPPHLSDPSHS-PVSERMDRSGTGSFHRRTSSISQRLRL 184 >gb|KDO70546.1| hypothetical protein CISIN_1g011939mg [Citrus sinensis] gb|KDO70547.1| hypothetical protein CISIN_1g011939mg [Citrus sinensis] Length = 474 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/43 (74%), Positives = 32/43 (74%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMS 21 E TR SGSLP LSDPSHSP VSERMDRSGTGSH R S S Sbjct: 150 ERVTRSLHSGSLPPHLSDPSHSP-VSERMDRSGTGSHHRRSSS 191 >dbj|GAY33016.1| hypothetical protein CUMW_005230 [Citrus unshiu] dbj|GAY33019.1| hypothetical protein CUMW_005230 [Citrus unshiu] Length = 684 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/43 (74%), Positives = 32/43 (74%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMS 21 E TR SGSLP LSDPSHSP VSERMDRSGTGSH R S S Sbjct: 150 ERVTRSLHSGSLPPHLSDPSHSP-VSERMDRSGTGSHHRRSSS 191 >ref|XP_006481709.1| PREDICTED: uncharacterized protein LOC102631068 [Citrus sinensis] Length = 684 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/43 (74%), Positives = 32/43 (74%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMS 21 E TR SGSLP LSDPSHSP VSERMDRSGTGSH R S S Sbjct: 150 ERVTRSLHSGSLPPHLSDPSHSP-VSERMDRSGTGSHHRRSSS 191 >ref|XP_024188522.1| uncharacterized protein LOC112192853 [Rosa chinensis] gb|PRQ44052.1| hypothetical protein RchiOBHm_Chr3g0474981 [Rosa chinensis] Length = 685 Score = 57.8 bits (138), Expect = 3e-06 Identities = 36/56 (64%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -3 Query: 167 IRGAYEESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRISMSQKPPRL 3 IR +E R RSGSLP LSDPSHS PVSERMDRSGTGS HRR S + RL Sbjct: 132 IRAREKERVARSLRSGSLPPHLSDPSHS-PVSERMDRSGTGSLHRRSSSISQRLRL 186 >ref|XP_006430122.1| uncharacterized protein At5g41620 isoform X1 [Citrus clementina] gb|ESR43362.1| hypothetical protein CICLE_v10011212mg [Citrus clementina] Length = 685 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/43 (74%), Positives = 32/43 (74%) Frame = -3 Query: 149 ESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGSHRRISMS 21 E TR SGSLP LSDPSHSP VSERMDRSGTGSH R S S Sbjct: 151 ERVTRSLHSGSLPPHLSDPSHSP-VSERMDRSGTGSHHRRSSS 192 >ref|XP_019425234.1| PREDICTED: uncharacterized protein At5g41620 [Lupinus angustifolius] Length = 672 Score = 56.6 bits (135), Expect = 8e-06 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = -3 Query: 167 IRGAYEESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRI-SMSQKP 12 +RG +E R RSGS P LSDPSHS PVSERMDRSGTGS HRR S+SQ+P Sbjct: 136 VRG--KERVVRSIRSGSFPPHLSDPSHS-PVSERMDRSGTGSRHRRTPSISQRP 186 >gb|OIV92197.1| hypothetical protein TanjilG_31116 [Lupinus angustifolius] Length = 680 Score = 56.6 bits (135), Expect = 8e-06 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = -3 Query: 167 IRGAYEESDTRLHRSGSLPQRLSDPSHSPPVSERMDRSGTGS-HRRI-SMSQKP 12 +RG +E R RSGS P LSDPSHS PVSERMDRSGTGS HRR S+SQ+P Sbjct: 136 VRG--KERVVRSIRSGSFPPHLSDPSHS-PVSERMDRSGTGSRHRRTPSISQRP 186