BLASTX nr result
ID: Chrysanthemum21_contig00038003
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00038003 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY88140.1| hypothetical protein LSAT_0X31381 [Lactuca sativa] 58 2e-06 ref|XP_023760329.1| paired amphipathic helix protein Sin3-like 2... 58 2e-06 >gb|PLY88140.1| hypothetical protein LSAT_0X31381 [Lactuca sativa] Length = 1276 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 YEITVIEDEEAPAKRTVEFEEAISFVNKIK 92 YEITVIED+EAP KRT+EFEEAISFVNKIK Sbjct: 127 YEITVIEDDEAPPKRTIEFEEAISFVNKIK 156 >ref|XP_023760329.1| paired amphipathic helix protein Sin3-like 2 [Lactuca sativa] Length = 1316 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 YEITVIEDEEAPAKRTVEFEEAISFVNKIK 92 YEITVIED+EAP KRT+EFEEAISFVNKIK Sbjct: 129 YEITVIEDDEAPPKRTIEFEEAISFVNKIK 158