BLASTX nr result
ID: Chrysanthemum21_contig00037922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037922 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI02070.1| F-box associated domain, type 1 [Cynara carduncul... 59 3e-07 ref|XP_023741651.1| F-box/kelch-repeat protein At3g06240-like [L... 57 1e-06 gb|KVI02071.1| F-box associated domain, type 1 [Cynara carduncul... 56 2e-06 >gb|KVI02070.1| F-box associated domain, type 1 [Cynara cardunculus var. scolymus] Length = 384 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +1 Query: 1 LLVYCPRKKTVEKRDFFKPYFTGEAYHPSFLKLETFEPQRVLVF 132 LLVYCP+ KT+E + F+PYF+G Y PSFLKL F +RV +F Sbjct: 341 LLVYCPQSKTIEHTEMFEPYFSGLPYRPSFLKLRDFASERVRMF 384 >ref|XP_023741651.1| F-box/kelch-repeat protein At3g06240-like [Lactuca sativa] Length = 385 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = +1 Query: 1 LLVYCPRKKTVEKRDFFKPYFTGEAYHPSFLKLETFEPQRVLV 129 LL YCP++KT++ + F YFTG AY PSFLKL+ F+ +RV V Sbjct: 342 LLAYCPKRKTIDDTEIFDRYFTGMAYRPSFLKLQNFKSERVHV 384 >gb|KVI02071.1| F-box associated domain, type 1 [Cynara cardunculus var. scolymus] Length = 385 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +1 Query: 1 LLVYCPRKKTVEKRDFFKPYFTGEAYHPSFLKLETFEPQRVLV 129 LL YCP+ KTVE + F Y +G AY PSFLKLE FE +RV V Sbjct: 342 LLSYCPKSKTVENTEIFDRYLSGMAYRPSFLKLENFESERVHV 384