BLASTX nr result
ID: Chrysanthemum21_contig00037674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037674 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH97857.1| DNA/RNA helicase, DEAD/DEAH box type, N-terminal ... 61 1e-07 >gb|KVH97857.1| DNA/RNA helicase, DEAD/DEAH box type, N-terminal [Cynara cardunculus var. scolymus] Length = 1256 Score = 60.8 bits (146), Expect = 1e-07 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 12/92 (13%) Frame = +3 Query: 282 AEEGDTVFDANNSSFYLGSEEASIQKKESQVKNYW------------SRXXXXXXXXXXX 425 +EEG+T+FDA++SSFYLG + AS+QKKE++V S+ Sbjct: 362 SEEGNTLFDADSSSFYLG-DVASVQKKEAEVTKRLVRRDGTQMTLAQSKKLSQLTADNAQ 420 Query: 426 XXXXXXXGSGAARDTKPPFLDGSNVFKEQA*P 521 SGA RDTKPPFLDG VF +QA P Sbjct: 421 WEDRQLLRSGAVRDTKPPFLDGRIVFTKQAEP 452