BLASTX nr result
ID: Chrysanthemum21_contig00037589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037589 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH92178.1| hypothetical protein Ccrd_005791 [Cynara carduncu... 109 1e-25 gb|PLY88934.1| hypothetical protein LSAT_8X89041 [Lactuca sativa] 106 3e-25 ref|XP_021969814.1| pentatricopeptide repeat-containing protein ... 108 3e-25 ref|XP_023759199.1| pentatricopeptide repeat-containing protein ... 104 7e-24 ref|XP_011024593.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-21 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 98 2e-21 ref|XP_011089644.1| pentatricopeptide repeat-containing protein ... 98 3e-21 ref|XP_019190261.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-19 gb|PIN14016.1| hypothetical protein CDL12_13363 [Handroanthus im... 92 4e-19 ref|XP_018844176.1| PREDICTED: pentatricopeptide repeat-containi... 91 8e-19 ref|XP_012085223.1| pentatricopeptide repeat-containing protein ... 91 1e-18 ref|XP_008368045.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 91 1e-18 ref|XP_008382582.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-18 ref|XP_018506448.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-18 ref|XP_021814161.1| pentatricopeptide repeat-containing protein ... 90 2e-18 ref|XP_021655305.1| pentatricopeptide repeat-containing protein ... 90 2e-18 dbj|GAU47218.1| hypothetical protein TSUD_403590 [Trifolium subt... 86 3e-18 ref|XP_007199919.1| pentatricopeptide repeat-containing protein ... 89 5e-18 ref|XP_008244680.1| PREDICTED: pentatricopeptide repeat-containi... 89 5e-18 ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phas... 89 6e-18 >gb|KVH92178.1| hypothetical protein Ccrd_005791 [Cynara cardunculus var. scolymus] Length = 380 Score = 109 bits (272), Expect = 1e-25 Identities = 50/62 (80%), Positives = 57/62 (91%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ +SM PD+LTYKT++EGLCREGRVDDAFD+LEEFRKKDSFMNEKTYK+LLN LHY S Sbjct: 319 DMLNDSMQPDMLTYKTLLEGLCREGRVDDAFDILEEFRKKDSFMNEKTYKNLLNGLHYVS 378 Query: 181 *K 186 K Sbjct: 379 CK 380 >gb|PLY88934.1| hypothetical protein LSAT_8X89041 [Lactuca sativa] Length = 264 Score = 106 bits (264), Expect = 3e-25 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ SM+PDLLTYKT++EGLCREGRVDDAFD+LEEFRKKDSFMNEKTYK LL+ LHY S Sbjct: 205 DMLDNSMAPDLLTYKTLLEGLCREGRVDDAFDILEEFRKKDSFMNEKTYKHLLDGLHYVS 264 >ref|XP_021969814.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Helianthus annuus] ref|XP_021969815.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Helianthus annuus] gb|OTG22503.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 372 Score = 108 bits (269), Expect = 3e-25 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+GESMSPDLLTYKTVVEGLCREG+VD+AFDV+EEFRKKDSFMNEKTYK LLN L Y + Sbjct: 313 DMLGESMSPDLLTYKTVVEGLCREGKVDEAFDVVEEFRKKDSFMNEKTYKVLLNGLRYVN 372 >ref|XP_023759199.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Lactuca sativa] Length = 379 Score = 104 bits (260), Expect = 7e-24 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHY 174 DM+ SM+PDLLTYKT++EGLCREGRVDDAFD+LEEFRKKDSFMNEKTYK LL+ LHY Sbjct: 316 DMLDNSMAPDLLTYKTLLEGLCREGRVDDAFDILEEFRKKDSFMNEKTYKHLLDGLHY 373 >ref|XP_011024593.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Populus euphratica] Length = 387 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+G+SMSPDLLTY+TV+EGLCREG VD AF++LEE+RKKD FM EK YKSLLN LH+ S Sbjct: 326 DMLGDSMSPDLLTYRTVLEGLCREGMVDKAFELLEEWRKKDGFMGEKNYKSLLNGLHFVS 385 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gb|PNT51549.1| hypothetical protein POPTR_002G248100v3 [Populus trichocarpa] Length = 387 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+G+SMSPDLLTY+TV+EGLCREG VD AF++LEE+RKKD FM EK YKSLLN LH+ S Sbjct: 326 DMLGDSMSPDLLTYRTVLEGLCREGMVDKAFELLEEWRKKDGFMGEKNYKSLLNGLHFVS 385 >ref|XP_011089644.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Sesamum indicum] Length = 375 Score = 97.8 bits (242), Expect = 3e-21 Identities = 44/60 (73%), Positives = 54/60 (90%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+G SMSPDLLTYKT++E +CR+GR DDAF++LEEFRK+DSFMNEKTY +LLN LH+ S Sbjct: 313 DMLGSSMSPDLLTYKTLLEEMCRDGRGDDAFELLEEFRKRDSFMNEKTYNTLLNGLHFLS 372 >ref|XP_019190261.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Ipomoea nil] Length = 380 Score = 92.8 bits (229), Expect = 2e-19 Identities = 42/60 (70%), Positives = 53/60 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ SMSPDLLTYKTV+E +CR+G+ + AFD+LEEFRK+D+FMNEKTYKSLL+ LH+ S Sbjct: 319 DMLSNSMSPDLLTYKTVLEEMCRDGKGEKAFDLLEEFRKRDNFMNEKTYKSLLDVLHFLS 378 >gb|PIN14016.1| hypothetical protein CDL12_13363 [Handroanthus impetiginosus] Length = 378 Score = 92.0 bits (227), Expect = 4e-19 Identities = 41/58 (70%), Positives = 52/58 (89%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHY 174 DM+G SMSPDLLTYKT++E +CR+GR +DAF++LE FRK+DSFMNEKTY +LLN LH+ Sbjct: 316 DMLGNSMSPDLLTYKTLLEEMCRDGRGNDAFELLEGFRKRDSFMNEKTYNTLLNGLHF 373 >ref|XP_018844176.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Juglans regia] Length = 391 Score = 91.3 bits (225), Expect = 8e-19 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM G SMSPDLLTYKT++EG+CREGR +DAF++L+E RK+D MNEKTY +LLN LH+ S Sbjct: 330 DMFGNSMSPDLLTYKTLLEGMCREGRGNDAFELLDEMRKRDPSMNEKTYNALLNGLHFVS 389 >ref|XP_012085223.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Jatropha curcas] gb|KDP45277.1| hypothetical protein JCGZ_15142 [Jatropha curcas] Length = 385 Score = 90.9 bits (224), Expect = 1e-18 Identities = 40/57 (70%), Positives = 50/57 (87%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELH 171 DM+G SMSPDLLTYKTV+EGLCREG+ D+AF+++EEFRK+D M++KTY LLN LH Sbjct: 324 DMLGNSMSPDLLTYKTVLEGLCREGKSDEAFELIEEFRKRDGLMSQKTYNILLNALH 380 >ref|XP_008368045.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Malus domestica] Length = 359 Score = 90.5 bits (223), Expect = 1e-18 Identities = 39/60 (65%), Positives = 53/60 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ +MSPDLLTYKT++EGLCR+G+ +AFD+LE+FR+KDS MNE+TYK+LLN LH+ + Sbjct: 298 DMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDFRRKDSMMNERTYKTLLNALHFVN 357 >ref|XP_008382582.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Malus domestica] Length = 396 Score = 90.5 bits (223), Expect = 1e-18 Identities = 39/60 (65%), Positives = 53/60 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ +MSPDLLTYKT++EGLCR+G+ +AFD+LE+FR+KDS MNE+TYK+LLN LH+ + Sbjct: 335 DMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDFRRKDSMMNERTYKTLLNALHFVN 394 >ref|XP_018506448.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Pyrus x bretschneideri] Length = 409 Score = 90.5 bits (223), Expect = 2e-18 Identities = 39/60 (65%), Positives = 53/60 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ +MSPDLLTYKT++EGLCR+G+ +AFD+LE+FR+KDS MNE+TYK+LLN LH+ + Sbjct: 348 DMLSNAMSPDLLTYKTLLEGLCRDGKGVEAFDLLEDFRRKDSMMNERTYKTLLNALHFVN 407 >ref|XP_021814161.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Prunus avium] Length = 390 Score = 90.1 bits (222), Expect = 2e-18 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ SMSPDLLTYKT++EGLCR+G+ +AFD+LEEFRK DS M EKTYK+LLN LH+ + Sbjct: 329 DMLSNSMSPDLLTYKTLLEGLCRDGKGSEAFDLLEEFRKGDSKMGEKTYKTLLNALHFVN 388 >ref|XP_021655305.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Hevea brasiliensis] Length = 395 Score = 90.1 bits (222), Expect = 2e-18 Identities = 39/58 (67%), Positives = 52/58 (89%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHY 174 DM+G+S +PDLLTYKTV+EGLCREG+ D+AF++LEE RK+D M++KTYK+LLN LH+ Sbjct: 334 DMLGQSRAPDLLTYKTVLEGLCREGKSDEAFELLEECRKRDRLMSQKTYKTLLNSLHF 391 >dbj|GAU47218.1| hypothetical protein TSUD_403590 [Trifolium subterraneum] Length = 166 Score = 85.9 bits (211), Expect = 3e-18 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHY 174 DM+ S SPD LTYKTV+EGLCREGRVDDAF++L+E +K+D +MNEK YK+L N+L + Sbjct: 105 DMLSNSRSPDHLTYKTVLEGLCREGRVDDAFELLDECKKRDFYMNEKMYKTLFNDLQF 162 >ref|XP_007199919.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Prunus persica] gb|ONH92765.1| hypothetical protein PRUPE_8G194300 [Prunus persica] Length = 390 Score = 89.0 bits (219), Expect = 5e-18 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ SMSPDLLTYKT++EGLCR+G+ +AFD+LE+FRK DS M EKTYK+LLN LH+ + Sbjct: 329 DMLSNSMSPDLLTYKTLLEGLCRDGKGSEAFDLLEDFRKGDSKMGEKTYKTLLNALHFVN 388 >ref|XP_008244680.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Prunus mume] Length = 397 Score = 89.0 bits (219), Expect = 5e-18 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYAS 180 DM+ SMSPDLLTYKT++EGLCR+G+ +AFD+LE+FRK DS M EKTYK+LLN LH+ + Sbjct: 336 DMLSNSMSPDLLTYKTLLEGLCRDGKGSEAFDLLEDFRKGDSKMGEKTYKTLLNALHFVN 395 >ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] gb|ESW19937.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] Length = 373 Score = 88.6 bits (218), Expect = 6e-18 Identities = 39/59 (66%), Positives = 52/59 (88%) Frame = +1 Query: 1 DMVGESMSPDLLTYKTVVEGLCREGRVDDAFDVLEEFRKKDSFMNEKTYKSLLNELHYA 177 DM+G+S SPD LTYKTV+EGLCREGRVDDAF++L+E +K+D+ M EK YK+LL +LH++ Sbjct: 312 DMLGQSRSPDHLTYKTVLEGLCREGRVDDAFELLDECKKRDASMGEKMYKTLLEDLHFS 370