BLASTX nr result
ID: Chrysanthemum21_contig00037576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037576 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60280.1| hypothetical protein M569_14524, partial [Genlise... 67 1e-10 ref|XP_017237187.1| PREDICTED: two-component response regulator-... 69 1e-10 ref|XP_017237188.1| PREDICTED: two-component response regulator-... 69 2e-10 gb|KNA04853.1| hypothetical protein SOVF_195890 isoform C [Spina... 68 3e-10 ref|XP_021858305.1| two-component response regulator-like APRR5 ... 68 3e-10 ref|XP_021977583.1| two-component response regulator-like APRR3 ... 68 3e-10 ref|XP_015572414.1| PREDICTED: two-component response regulator-... 68 3e-10 ref|XP_023754941.1| two-component response regulator-like APRR5 ... 67 5e-10 gb|KVI04576.1| CCT domain-containing protein [Cynara cardunculus... 67 5e-10 ref|XP_021889746.1| two-component response regulator-like APRR7 ... 67 6e-10 ref|XP_021889744.1| two-component response regulator-like APRR3 ... 67 6e-10 ref|XP_021889742.1| two-component response regulator-like APRR7 ... 67 6e-10 ref|XP_011025367.1| PREDICTED: two-component response regulator-... 67 7e-10 ref|XP_011025366.1| PREDICTED: two-component response regulator-... 67 7e-10 ref|XP_011025365.1| PREDICTED: two-component response regulator-... 67 7e-10 ref|XP_011025364.1| PREDICTED: two-component response regulator-... 67 7e-10 ref|XP_012570305.1| PREDICTED: two-component response regulator-... 67 7e-10 ref|XP_012570304.1| PREDICTED: two-component response regulator-... 67 7e-10 ref|XP_012570298.1| PREDICTED: two-component response regulator-... 67 7e-10 gb|OAE28659.1| hypothetical protein AXG93_2865s1000 [Marchantia ... 67 7e-10 >gb|EPS60280.1| hypothetical protein M569_14524, partial [Genlisea aurea] Length = 178 Score = 66.6 bits (161), Expect = 1e-10 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 12/61 (19%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQ-SDNTRFLG---ESKGH 360 +MS+HDS+ +GAADFLVKPVRKNELKNLWQHVWR+Q S N LG ES G Sbjct: 103 MMSSHDSVSTVYRCMLRGAADFLVKPVRKNELKNLWQHVWRKQASVNVASLGHPDESIGQ 162 Query: 361 K 363 K Sbjct: 163 K 163 >ref|XP_017237187.1| PREDICTED: two-component response regulator-like APRR3 isoform X1 [Daucus carota subsp. sativus] gb|KZN01820.1| hypothetical protein DCAR_010574 [Daucus carota subsp. sativus] Length = 670 Score = 68.9 bits (167), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 8/46 (17%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDN 330 +MSAHDS+ +GAADFLVKPVRKNELKNLWQHVWRRQS + Sbjct: 105 MMSAHDSVNTVYKCMLRGAADFLVKPVRKNELKNLWQHVWRRQSQS 150 >ref|XP_017237188.1| PREDICTED: two-component response regulator-like APRR5 isoform X2 [Daucus carota subsp. sativus] Length = 669 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/44 (75%), Positives = 36/44 (81%), Gaps = 8/44 (18%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQS 324 +MSAHDS+ +GAADFLVKPVRKNELKNLWQHVWRRQS Sbjct: 105 MMSAHDSVNTVYKCMLRGAADFLVKPVRKNELKNLWQHVWRRQS 148 >gb|KNA04853.1| hypothetical protein SOVF_195890 isoform C [Spinacia oleracea] Length = 644 Score = 68.2 bits (165), Expect = 3e-10 Identities = 35/51 (68%), Positives = 37/51 (72%), Gaps = 8/51 (15%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLG 345 +MS HDSI KGAADFLVKP+R NELKNLWQHVWRRQS N LG Sbjct: 129 MMSTHDSIGMVYKCMLKGAADFLVKPIRINELKNLWQHVWRRQSLNREGLG 179 >ref|XP_021858305.1| two-component response regulator-like APRR5 isoform X2 [Spinacia oleracea] Length = 650 Score = 68.2 bits (165), Expect = 3e-10 Identities = 35/51 (68%), Positives = 37/51 (72%), Gaps = 8/51 (15%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLG 345 +MS HDSI KGAADFLVKP+R NELKNLWQHVWRRQS N LG Sbjct: 129 MMSTHDSIGMVYKCMLKGAADFLVKPIRINELKNLWQHVWRRQSLNREGLG 179 >ref|XP_021977583.1| two-component response regulator-like APRR3 [Helianthus annuus] gb|OTG18699.1| putative CCT domain, CheY-like superfamily [Helianthus annuus] Length = 654 Score = 67.8 bits (164), Expect = 3e-10 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 8/47 (17%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNT 333 +MSAH+S+ +GA+DFLVKPVRKNELKNLWQHVWRRQS T Sbjct: 174 MMSAHESVSTVYKCMLRGASDFLVKPVRKNELKNLWQHVWRRQSSTT 220 >ref|XP_015572414.1| PREDICTED: two-component response regulator-like APRR9 isoform X2 [Ricinus communis] Length = 669 Score = 67.8 bits (164), Expect = 3e-10 Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 8/56 (14%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGH 360 +MS+HDSI KGAADFL+KPVR+NELKNLWQHVWRRQ+ + H Sbjct: 121 MMSSHDSISKVLKCMLKGAADFLIKPVRRNELKNLWQHVWRRQTHRVEAASSASDH 176 >ref|XP_023754941.1| two-component response regulator-like APRR5 [Lactuca sativa] gb|PLY92142.1| hypothetical protein LSAT_8X4341 [Lactuca sativa] Length = 573 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 8/44 (18%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQS 324 +MSAHDS+ +GAADFLVKPVRKNELKNLWQHVWRRQ+ Sbjct: 136 MMSAHDSVSTVYKCMLRGAADFLVKPVRKNELKNLWQHVWRRQA 179 >gb|KVI04576.1| CCT domain-containing protein [Cynara cardunculus var. scolymus] Length = 606 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 8/44 (18%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQS 324 +MSAHDS+ +GAADFLVKPVRKNELKNLWQHVWRRQ+ Sbjct: 137 MMSAHDSVSTVYKCMLRGAADFLVKPVRKNELKNLWQHVWRRQA 180 >ref|XP_021889746.1| two-component response regulator-like APRR7 isoform X3 [Carica papaya] ref|XP_021889747.1| two-component response regulator-like APRR7 isoform X3 [Carica papaya] Length = 507 Score = 67.0 bits (162), Expect = 6e-10 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 8/62 (12%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYKA 372 +MS+HDS+ KGA DFLVKP+RKNELKNLWQHVWRR ++ ES H K+ Sbjct: 151 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTHTKKS 210 Query: 373 VR 378 V+ Sbjct: 211 VK 212 >ref|XP_021889744.1| two-component response regulator-like APRR3 isoform X2 [Carica papaya] Length = 528 Score = 67.0 bits (162), Expect = 6e-10 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 8/62 (12%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYKA 372 +MS+HDS+ KGA DFLVKP+RKNELKNLWQHVWRR ++ ES H K+ Sbjct: 177 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTHTKKS 236 Query: 373 VR 378 V+ Sbjct: 237 VK 238 >ref|XP_021889742.1| two-component response regulator-like APRR7 isoform X1 [Carica papaya] ref|XP_021889743.1| two-component response regulator-like APRR7 isoform X1 [Carica papaya] Length = 533 Score = 67.0 bits (162), Expect = 6e-10 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 8/62 (12%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYKA 372 +MS+HDS+ KGA DFLVKP+RKNELKNLWQHVWRR ++ ES H K+ Sbjct: 177 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTHTKKS 236 Query: 373 VR 378 V+ Sbjct: 237 VK 238 >ref|XP_011025367.1| PREDICTED: two-component response regulator-like APRR9 isoform X4 [Populus euphratica] Length = 690 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 8/59 (13%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYK 369 +MS+HDSI KGAADFLVKPVRKNEL+NLWQHVWRRQ T G+ G+ ++ Sbjct: 124 MMSSHDSISVVLKCMLKGAADFLVKPVRKNELRNLWQHVWRRQ---TLIAGKIPGNSHQ 179 >ref|XP_011025366.1| PREDICTED: two-component response regulator-like APRR9 isoform X3 [Populus euphratica] Length = 695 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 8/59 (13%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYK 369 +MS+HDSI KGAADFLVKPVRKNEL+NLWQHVWRRQ T G+ G+ ++ Sbjct: 124 MMSSHDSISVVLKCMLKGAADFLVKPVRKNELRNLWQHVWRRQ---TLIAGKIPGNSHQ 179 >ref|XP_011025365.1| PREDICTED: two-component response regulator-like APRR9 isoform X2 [Populus euphratica] Length = 699 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 8/59 (13%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYK 369 +MS+HDSI KGAADFLVKPVRKNEL+NLWQHVWRRQ T G+ G+ ++ Sbjct: 124 MMSSHDSISVVLKCMLKGAADFLVKPVRKNELRNLWQHVWRRQ---TLIAGKIPGNSHQ 179 >ref|XP_011025364.1| PREDICTED: two-component response regulator-like APRR9 isoform X1 [Populus euphratica] Length = 709 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 8/59 (13%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYK 369 +MS+HDSI KGAADFLVKPVRKNEL+NLWQHVWRRQ T G+ G+ ++ Sbjct: 124 MMSSHDSISVVLKCMLKGAADFLVKPVRKNELRNLWQHVWRRQ---TLIAGKIPGNSHQ 179 >ref|XP_012570305.1| PREDICTED: two-component response regulator-like APRR7 isoform X3 [Cicer arietinum] Length = 757 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 8/63 (12%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYKA 372 +MSAHDS+ KGA DFLVKP+RKNELKNLWQHVWRR ++ ES K+ Sbjct: 171 MMSAHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTQTQKS 230 Query: 373 VRL 381 V+L Sbjct: 231 VKL 233 >ref|XP_012570304.1| PREDICTED: two-component response regulator-like APRR3 isoform X2 [Cicer arietinum] Length = 777 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 8/63 (12%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYKA 372 +MSAHDS+ KGA DFLVKP+RKNELKNLWQHVWRR ++ ES K+ Sbjct: 171 MMSAHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTQTQKS 230 Query: 373 VRL 381 V+L Sbjct: 231 VKL 233 >ref|XP_012570298.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Cicer arietinum] ref|XP_012570299.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Cicer arietinum] ref|XP_012570300.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Cicer arietinum] ref|XP_012570301.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Cicer arietinum] ref|XP_012570302.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Cicer arietinum] ref|XP_012570303.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Cicer arietinum] Length = 781 Score = 67.0 bits (162), Expect = 7e-10 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 8/63 (12%) Frame = +1 Query: 217 VMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDNTRFLGESKGHKYKA 372 +MSAHDS+ KGA DFLVKP+RKNELKNLWQHVWRR ++ ES K+ Sbjct: 171 MMSAHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTQTQKS 230 Query: 373 VRL 381 V+L Sbjct: 231 VKL 233 >gb|OAE28659.1| hypothetical protein AXG93_2865s1000 [Marchantia polymorpha subsp. ruderalis] Length = 948 Score = 67.0 bits (162), Expect = 7e-10 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 8/53 (15%) Frame = +1 Query: 196 GLRFDSSVMSAHDSI--------KGAADFLVKPVRKNELKNLWQHVWRRQSDN 330 G R +MS+HDS+ KGAADFLVKPVRKNELKNLWQHVWR QS + Sbjct: 294 GKRIPVIMMSSHDSLDIVYRCLFKGAADFLVKPVRKNELKNLWQHVWRCQSSS 346