BLASTX nr result
ID: Chrysanthemum21_contig00037567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037567 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109494.1| hypothetical protein Poptr_cp015 [Populus tr... 66 1e-11 gb|AVK41920.1| hypothetical protein (chloroplast) [Populus wilso... 52 4e-06 >ref|YP_001109494.1| hypothetical protein Poptr_cp015 [Populus trichocarpa] gb|ABO36697.1| conserved hypothetical protein (chloroplast) [Populus trichocarpa] gb|APO08990.1| hypothetical protein (chloroplast) [Populus nigra] Length = 56 Score = 66.2 bits (160), Expect = 1e-11 Identities = 34/55 (61%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +2 Query: 329 LNWKYRQIL--AESKEMKINRKGGQLVPISSLLNLNIRIADIVMIQWVRSTYFSF 487 +N KYRQI + MK+ K G VPISS+ NL IRI DIVMIQWVRSTYF F Sbjct: 1 MNQKYRQIFFFGVQRNMKMKEKSGSTVPISSISNLTIRIVDIVMIQWVRSTYFFF 55 >gb|AVK41920.1| hypothetical protein (chloroplast) [Populus wilsonii] Length = 48 Score = 51.6 bits (122), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 364 QRNENK*KRGSTCSNFISIEFEYQNSGYSHDSMG 465 ++ EN+ K+ CSNFI IEF+YQNSGYSHDSMG Sbjct: 15 KKYENERKKRIYCSNFIYIEFDYQNSGYSHDSMG 48