BLASTX nr result
ID: Chrysanthemum21_contig00037558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037558 (766 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH20947.1| hypothetical protein Ccrd_025896 [Cynara carduncu... 59 2e-06 >gb|KVH20947.1| hypothetical protein Ccrd_025896 [Cynara cardunculus var. scolymus] Length = 236 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = -2 Query: 306 LVGNDDSTHVQLSIKSFPPAGLTA*SLPKKVILGVCIFLIYPYFECFHTIL 154 ++GNDD THVQLSI +FPPA LTA + P V+L VCIFLI P C ++L Sbjct: 183 MLGNDDRTHVQLSINAFPPACLTAKAHPNTVLLDVCIFLI-PRCPCLASVL 232