BLASTX nr result
ID: Chrysanthemum21_contig00037551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037551 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023750399.1| protein ABIL2-like isoform X4 [Lactuca sativa] 69 2e-11 ref|XP_023750398.1| protein ABIL2-like isoform X3 [Lactuca sativa] 69 2e-11 ref|XP_023750397.1| protein ABIL2-like isoform X2 [Lactuca sativa] 69 3e-11 ref|XP_023750396.1| protein ABIL2-like isoform X1 [Lactuca sativa] 69 3e-11 gb|KVH95299.1| hypothetical protein Ccrd_002632 [Cynara carduncu... 62 2e-09 ref|XP_022029239.1| protein ABIL2-like isoform X6 [Helianthus an... 62 6e-09 ref|XP_022029238.1| protein ABIL2-like isoform X5 [Helianthus an... 62 6e-09 ref|XP_022029237.1| protein ABIL2-like isoform X4 [Helianthus an... 62 6e-09 ref|XP_022029236.1| protein ABIL2-like isoform X3 [Helianthus an... 62 6e-09 ref|XP_022029235.1| protein ABIL2-like isoform X2 [Helianthus an... 62 6e-09 ref|XP_022029234.1| protein ABIL2-like isoform X1 [Helianthus an... 62 6e-09 gb|PLY64884.1| hypothetical protein LSAT_3X12861 [Lactuca sativa] 61 2e-08 ref|XP_023745604.1| protein ABIL2-like isoform X2 [Lactuca sativa] 61 2e-08 ref|XP_023745603.1| protein ABIL2-like isoform X1 [Lactuca sativa] 61 2e-08 ref|XP_022026014.1| protein ABIL2-like [Helianthus annuus] >gi|1... 59 1e-07 ref|XP_018855015.1| PREDICTED: protein ABIL3-like [Juglans regia... 56 2e-07 ref|XP_018824612.1| PREDICTED: protein ABIL2-like [Juglans regia] 58 3e-07 ref|XP_010519446.1| PREDICTED: protein ABIL2-like [Tarenaya hass... 56 1e-06 gb|AAZ74718.1| At5g24310, partial [Arabidopsis thaliana] >gi|733... 53 2e-06 gb|AAZ74719.1| At5g24310, partial [Arabidopsis thaliana] 53 2e-06 >ref|XP_023750399.1| protein ABIL2-like isoform X4 [Lactuca sativa] Length = 248 Score = 68.6 bits (166), Expect = 2e-11 Identities = 36/50 (72%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 L ESLKNYIS SLIKTIDHL V YK + FLD NVNE SR L LCIEQ Sbjct: 54 LFESLKNYISKSLIKTIDHLGSVMYKLNNFLDHNVNEASRLNLQLLCIEQ 103 >ref|XP_023750398.1| protein ABIL2-like isoform X3 [Lactuca sativa] Length = 249 Score = 68.6 bits (166), Expect = 2e-11 Identities = 36/50 (72%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 L ESLKNYIS SLIKTIDHL V YK + FLD NVNE SR L LCIEQ Sbjct: 54 LFESLKNYISKSLIKTIDHLGSVMYKLNNFLDHNVNEASRLNLQLLCIEQ 103 >ref|XP_023750397.1| protein ABIL2-like isoform X2 [Lactuca sativa] Length = 270 Score = 68.6 bits (166), Expect = 3e-11 Identities = 36/50 (72%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 L ESLKNYIS SLIKTIDHL V YK + FLD NVNE SR L LCIEQ Sbjct: 54 LFESLKNYISKSLIKTIDHLGSVMYKLNNFLDHNVNEASRLNLQLLCIEQ 103 >ref|XP_023750396.1| protein ABIL2-like isoform X1 [Lactuca sativa] Length = 271 Score = 68.6 bits (166), Expect = 3e-11 Identities = 36/50 (72%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 L ESLKNYIS SLIKTIDHL V YK + FLD NVNE SR L LCIEQ Sbjct: 54 LFESLKNYISKSLIKTIDHLGSVMYKLNNFLDHNVNEASRLNLQLLCIEQ 103 >gb|KVH95299.1| hypothetical protein Ccrd_002632 [Cynara cardunculus var. scolymus] Length = 173 Score = 62.4 bits (150), Expect = 2e-09 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQSFLHEL 185 L ESLK+Y+S +LI TIDHL VT K FL+ENV+EV T L LC+EQS + +L Sbjct: 65 LFESLKDYVSKALISTIDHLGSVTSKVDSFLNENVDEVFETNLGVLCMEQSIISDL 120 >ref|XP_022029239.1| protein ABIL2-like isoform X6 [Helianthus annuus] Length = 297 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+YIS S++KT+DHL VT K +K LDE+VNEVS+TKL IEQ Sbjct: 64 LLESLKDYISKSMLKTVDHLGCVTNKVNKLLDEHVNEVSKTKLLVSGIEQ 113 >ref|XP_022029238.1| protein ABIL2-like isoform X5 [Helianthus annuus] gb|OTG32175.1| putative ABI family [Helianthus annuus] Length = 299 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+YIS S++KT+DHL VT K +K LDE+VNEVS+TKL IEQ Sbjct: 64 LLESLKDYISKSMLKTVDHLGCVTNKVNKLLDEHVNEVSKTKLLVSGIEQ 113 >ref|XP_022029237.1| protein ABIL2-like isoform X4 [Helianthus annuus] Length = 302 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+YIS S++KT+DHL VT K +K LDE+VNEVS+TKL IEQ Sbjct: 64 LLESLKDYISKSMLKTVDHLGCVTNKVNKLLDEHVNEVSKTKLLVSGIEQ 113 >ref|XP_022029236.1| protein ABIL2-like isoform X3 [Helianthus annuus] Length = 305 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+YIS S++KT+DHL VT K +K LDE+VNEVS+TKL IEQ Sbjct: 64 LLESLKDYISKSMLKTVDHLGCVTNKVNKLLDEHVNEVSKTKLLVSGIEQ 113 >ref|XP_022029235.1| protein ABIL2-like isoform X2 [Helianthus annuus] Length = 307 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+YIS S++KT+DHL VT K +K LDE+VNEVS+TKL IEQ Sbjct: 64 LLESLKDYISKSMLKTVDHLGCVTNKVNKLLDEHVNEVSKTKLLVSGIEQ 113 >ref|XP_022029234.1| protein ABIL2-like isoform X1 [Helianthus annuus] Length = 310 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+YIS S++KT+DHL VT K +K LDE+VNEVS+TKL IEQ Sbjct: 64 LLESLKDYISKSMLKTVDHLGCVTNKVNKLLDEHVNEVSKTKLLVSGIEQ 113 >gb|PLY64884.1| hypothetical protein LSAT_3X12861 [Lactuca sativa] Length = 287 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+Y+S +L+ TIDHL V+ K + FLDEN+NE T L LCIEQ Sbjct: 61 LLESLKDYVSKALVSTIDHLGSVSSKINSFLDENLNEALETNLQILCIEQ 110 >ref|XP_023745604.1| protein ABIL2-like isoform X2 [Lactuca sativa] Length = 290 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+Y+S +L+ TIDHL V+ K + FLDEN+NE T L LCIEQ Sbjct: 64 LLESLKDYVSKALVSTIDHLGSVSSKINSFLDENLNEALETNLQILCIEQ 113 >ref|XP_023745603.1| protein ABIL2-like isoform X1 [Lactuca sativa] Length = 291 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+Y+S +L+ TIDHL V+ K + FLDEN+NE T L LCIEQ Sbjct: 64 LLESLKDYVSKALVSTIDHLGSVSSKINSFLDENLNEALETNLQILCIEQ 113 >ref|XP_022026014.1| protein ABIL2-like [Helianthus annuus] gb|OTF84947.1| putative ABI family [Helianthus annuus] Length = 282 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 LLESLK+Y+S +LI TIDHL VT K + FLDEN++E T L +CI+Q Sbjct: 58 LLESLKDYVSKALISTIDHLGSVTSKVNSFLDENIDEAYETNLRVVCIKQ 107 >ref|XP_018855015.1| PREDICTED: protein ABIL3-like [Juglans regia] ref|XP_018855016.1| PREDICTED: protein ABIL3-like [Juglans regia] ref|XP_018855017.1| PREDICTED: protein ABIL3-like [Juglans regia] ref|XP_018855018.1| PREDICTED: protein ABIL3-like [Juglans regia] Length = 117 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 ++E+LK+Y + +++ T+DHL VTYK FLDE V+EVS T+L CIEQ Sbjct: 64 VIETLKDYATKAIVNTVDHLGSVTYKVDDFLDEKVDEVSGTELRVSCIEQ 113 >ref|XP_018824612.1| PREDICTED: protein ABIL2-like [Juglans regia] Length = 492 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = +3 Query: 15 RLLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 R++E+LK+Y + +++ T+DHL VTYK FLDE V+EVS T+L CIEQ Sbjct: 228 RVIETLKDYATKAIVNTVDHLGSVTYKVDDFLDEKVDEVSGTELRVSCIEQ 278 >ref|XP_010519446.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana] ref|XP_010519447.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana] ref|XP_010519448.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana] ref|XP_010519449.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana] ref|XP_010519450.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana] Length = 321 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 ++E+LK+Y +L+ T+DHL VTYK S FLDE V+EVS T L CIEQ Sbjct: 61 VVETLKDYAIKALVNTVDHLGSVTYKVSDFLDEKVDEVSGTALRVSCIEQ 110 >gb|AAZ74718.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74720.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74721.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74722.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74723.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74724.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74725.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74726.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74727.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74728.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74729.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74730.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74731.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74732.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74733.1| At5g24310, partial [Arabidopsis thaliana] gb|AAZ74734.1| At5g24310, partial [Arabidopsis thaliana] Length = 111 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 ++E+LK+Y +L+ T+DHL VTYK + F+DE V+EV+ T+L CIEQ Sbjct: 29 VVETLKDYAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQ 78 >gb|AAZ74719.1| At5g24310, partial [Arabidopsis thaliana] Length = 111 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +3 Query: 18 LLESLKNYISNSLIKTIDHLD*VTYKFSKFLDENVNEVSRTKL*DLCIEQ 167 ++E+LK+Y +L+ T+DHL VTYK + F+DE V+EV+ T+L CIEQ Sbjct: 29 VVETLKDYAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQ 78