BLASTX nr result
ID: Chrysanthemum21_contig00037512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037512 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023747217.1| uncharacterized protein LOC111895365 [Lactuc... 55 8e-07 >ref|XP_023747217.1| uncharacterized protein LOC111895365 [Lactuca sativa] Length = 798 Score = 55.5 bits (132), Expect(2) = 8e-07 Identities = 25/70 (35%), Positives = 40/70 (57%) Frame = +3 Query: 120 MNWISWKLLWVFCNTIVLFLLMIVGCGIDLYSFLCPVCDDNIESTKHLFVHCNLASDLWG 299 +N + W+L NTIV + GID+ S CP+C +++++ HL C A DLW Sbjct: 649 VNILFWRLRLNKVNTIV----NLDRHGIDIGSVFCPICGNDVDTVNHLLFTCGQAMDLWS 704 Query: 300 SVFKWWKLDI 329 V +WW++D+ Sbjct: 705 LVSRWWEVDM 714 Score = 25.0 bits (53), Expect(2) = 8e-07 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 361 ITWVDSTNLPTLIKSFLDGVI 423 ++W+DST L IK LD V+ Sbjct: 724 LSWLDSTRLSIQIKRCLDAVV 744