BLASTX nr result
ID: Chrysanthemum21_contig00037467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037467 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022013619.1| multiple organellar RNA editing factor 7, mi... 65 9e-10 ref|XP_023772695.1| multiple organellar RNA editing factor 7, mi... 58 3e-07 >ref|XP_022013619.1| multiple organellar RNA editing factor 7, mitochondrial [Helianthus annuus] ref|XP_022013620.1| multiple organellar RNA editing factor 7, mitochondrial [Helianthus annuus] gb|OTF96707.1| hypothetical protein HannXRQ_Chr15g0497121 [Helianthus annuus] Length = 180 Score = 64.7 bits (156), Expect = 9e-10 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = -1 Query: 505 GEPLIDGCVVPYDEMFHEDWLQDRSGNGIXXXXXXXXXXRKEQKTD 368 GEP DGCVVPYDE FHEDWLQDRS NG RKE KTD Sbjct: 133 GEPFTDGCVVPYDETFHEDWLQDRSDNGFRRTTRRKRSRRKEHKTD 178 >ref|XP_023772695.1| multiple organellar RNA editing factor 7, mitochondrial isoform X1 [Lactuca sativa] gb|PLY78622.1| hypothetical protein LSAT_4X94060 [Lactuca sativa] Length = 196 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -1 Query: 505 GEPLIDGCVVPYDEMFHEDWLQDRSGNGIXXXXXXXXXXRKEQKTDNN 362 GEP IDG VVPYDEMFHEDW++D S NG RKEQK D+N Sbjct: 150 GEPFIDGHVVPYDEMFHEDWVKDESNNGF-RRRSGRRSRRKEQKIDSN 196