BLASTX nr result
ID: Chrysanthemum21_contig00037426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037426 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023746752.1| B3 domain-containing protein REM9-like [Lact... 61 3e-08 ref|XP_022021703.1| B3 domain-containing protein At5g60140-like ... 55 3e-06 gb|OTF88205.1| putative DNA-binding pseudobarrel domain-containi... 55 3e-06 ref|XP_023746756.1| B3 domain-containing protein REM2 [Lactuca s... 53 7e-06 >ref|XP_023746752.1| B3 domain-containing protein REM9-like [Lactuca sativa] Length = 554 Score = 60.8 bits (146), Expect = 3e-08 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +1 Query: 4 FRRSNNISEGDECVFKYIRSEDKMCLVRVTKRNTQARSSPP 126 FRR N + EGD+CVFK+I+SEDK+CL +VTK+ Q++ PP Sbjct: 266 FRRVNELCEGDKCVFKFIKSEDKLCLAKVTKKRVQSKQPPP 306 >ref|XP_022021703.1| B3 domain-containing protein At5g60140-like [Helianthus annuus] Length = 341 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 4 FRRSNNISEGDECVFKYIRSEDKMCLVRVTKRNTQAR 114 FRRSN++ EGDECVFK+IR+EDK+ L RVTK A+ Sbjct: 265 FRRSNDLCEGDECVFKFIRNEDKLLLARVTKNKRPAK 301 >gb|OTF88205.1| putative DNA-binding pseudobarrel domain-containing protein [Helianthus annuus] Length = 362 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 4 FRRSNNISEGDECVFKYIRSEDKMCLVRVTKRNTQAR 114 FRRSN++ EGDECVFK+IR+EDK+ L RVTK A+ Sbjct: 286 FRRSNDLCEGDECVFKFIRNEDKLLLARVTKNKRPAK 322 >ref|XP_023746756.1| B3 domain-containing protein REM2 [Lactuca sativa] Length = 172 Score = 52.8 bits (125), Expect = 7e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +1 Query: 4 FRRSNNISEGDECVFKYIRSEDKMCLVRVTKR 99 FRR N + EGD CVFKY+R+EDK+CL VTK+ Sbjct: 34 FRRDNELCEGDTCVFKYLRTEDKLCLAEVTKK 65