BLASTX nr result
ID: Chrysanthemum21_contig00037418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037418 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019183253.1| PREDICTED: bromodomain-containing protein DD... 54 1e-05 ref|XP_019183252.1| PREDICTED: uncharacterized protein LOC109178... 54 1e-05 >ref|XP_019183253.1| PREDICTED: bromodomain-containing protein DDB_G0270170 isoform X2 [Ipomoea nil] Length = 899 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 4 LMQSDVLLICSNAMQYNAPDTIYYKQQHII 93 L +SDVLLICSNAMQYNAPDTIYYKQ I Sbjct: 229 LFESDVLLICSNAMQYNAPDTIYYKQARSI 258 >ref|XP_019183252.1| PREDICTED: uncharacterized protein LOC109178145 isoform X1 [Ipomoea nil] Length = 902 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 4 LMQSDVLLICSNAMQYNAPDTIYYKQQHII 93 L +SDVLLICSNAMQYNAPDTIYYKQ I Sbjct: 229 LFESDVLLICSNAMQYNAPDTIYYKQARSI 258