BLASTX nr result
ID: Chrysanthemum21_contig00037382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037382 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIW12870.1| hypothetical protein TanjilG_24803 [Lupinus angus... 51 9e-06 >gb|OIW12870.1| hypothetical protein TanjilG_24803 [Lupinus angustifolius] Length = 101 Score = 51.2 bits (121), Expect = 9e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 12 QHNVQGLLLLNLMESPHDRYRVNQQSMQGL 101 Q NVQGL+ LNLME PHD Y VNQQSMQGL Sbjct: 18 QQNVQGLVQLNLMEPPHDSYYVNQQSMQGL 47