BLASTX nr result
ID: Chrysanthemum21_contig00037286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037286 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021990594.1| uncharacterized protein LOC110887006 [Helian... 55 1e-06 >ref|XP_021990594.1| uncharacterized protein LOC110887006 [Helianthus annuus] Length = 158 Score = 54.7 bits (130), Expect = 1e-06 Identities = 28/59 (47%), Positives = 36/59 (61%) Frame = -3 Query: 314 AAAAGKRRSIMXXXXXXXXSKQAANEWELDTLKIKTMDMGWYRHQDLSLLDGNVVRLWN 138 A AA RR I + WE LK+KT +MGWYR+QDL++LDG+VV+LWN Sbjct: 101 AVAARTRRPIKGSVHNPQRLVLGDHGWEA-LLKLKTAEMGWYRYQDLTMLDGSVVQLWN 158