BLASTX nr result
ID: Chrysanthemum21_contig00037270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037270 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023745641.1| protein NRDE2 homolog isoform X2 [Lactuca sa... 90 4e-18 ref|XP_023745640.1| protein NRDE2 homolog isoform X1 [Lactuca sa... 90 4e-18 ref|XP_022040918.1| protein NRDE2 homolog [Helianthus annuus] >g... 89 5e-18 gb|OAY83366.1| Protein NRDE, partial [Ananas comosus] 79 2e-16 ref|XP_022766820.1| protein NRDE2 homolog isoform X5 [Durio zibe... 82 2e-15 ref|XP_022766812.1| protein NRDE2 homolog isoform X4 [Durio zibe... 82 2e-15 gb|PIN25545.1| hypothetical protein CDL12_01738 [Handroanthus im... 82 2e-15 ref|XP_022766793.1| protein NRDE2 homolog isoform X2 [Durio zibe... 82 2e-15 emb|CDO98626.1| unnamed protein product [Coffea canephora] 82 2e-15 ref|XP_022766784.1| protein NRDE2 homolog isoform X1 [Durio zibe... 82 2e-15 gb|PKI53450.1| hypothetical protein CRG98_026140 [Punica granatum] 78 3e-15 gb|PAN08475.1| hypothetical protein PAHAL_G02682 [Panicum hallii... 81 4e-15 ref|XP_011072028.1| protein NRDE2 homolog [Sesamum indicum] 81 4e-15 gb|PHU23431.1| hypothetical protein BC332_08538 [Capsicum chinense] 81 4e-15 ref|XP_016563949.1| PREDICTED: protein NRDE2 homolog isoform X3 ... 81 5e-15 ref|XP_012704665.1| protein NRDE2 homolog [Setaria italica] >gi|... 81 5e-15 gb|PHT53487.1| hypothetical protein CQW23_07949 [Capsicum baccatum] 81 5e-15 ref|XP_016563947.1| PREDICTED: protein NRDE2 homolog isoform X1 ... 81 5e-15 gb|PHT87821.1| hypothetical protein T459_09927 [Capsicum annuum] 81 5e-15 emb|CAN63561.1| hypothetical protein VITISV_008646 [Vitis vinifera] 77 5e-15 >ref|XP_023745641.1| protein NRDE2 homolog isoform X2 [Lactuca sativa] gb|PLY64842.1| hypothetical protein LSAT_2X15380 [Lactuca sativa] Length = 1153 Score = 89.7 bits (221), Expect = 4e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMDVS 143 WLDGF KLSSVL+AKELSDLLEVMRDKE+NVRTDVYEILLQDEMDVS Sbjct: 1106 WLDGFVKLSSVLSAKELSDLLEVMRDKEMNVRTDVYEILLQDEMDVS 1152 >ref|XP_023745640.1| protein NRDE2 homolog isoform X1 [Lactuca sativa] Length = 1154 Score = 89.7 bits (221), Expect = 4e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMDVS 143 WLDGF KLSSVL+AKELSDLLEVMRDKE+NVRTDVYEILLQDEMDVS Sbjct: 1107 WLDGFVKLSSVLSAKELSDLLEVMRDKEMNVRTDVYEILLQDEMDVS 1153 >ref|XP_022040918.1| protein NRDE2 homolog [Helianthus annuus] gb|OTG35984.1| hypothetical protein HannXRQ_Chr01g0002621 [Helianthus annuus] Length = 1153 Score = 89.4 bits (220), Expect = 5e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMDVS 143 WLDGFTKL+SVLT KELSDLLEVMRDKE+NVRTDVYEILLQDEMD+S Sbjct: 1106 WLDGFTKLNSVLTTKELSDLLEVMRDKEINVRTDVYEILLQDEMDLS 1152 >gb|OAY83366.1| Protein NRDE, partial [Ananas comosus] Length = 124 Score = 79.3 bits (194), Expect = 2e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KLSS+LT KELSDL EVMRDKELN+RTD+YEILLQDE + Sbjct: 79 WLDGFQKLSSILTLKELSDLQEVMRDKELNIRTDIYEILLQDETE 123 >ref|XP_022766820.1| protein NRDE2 homolog isoform X5 [Durio zibethinus] Length = 1095 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEM 134 WLDGF KL+S+LTAKELSDLLEVMRDKELN+RTD+YEILLQDE+ Sbjct: 1050 WLDGFLKLNSILTAKELSDLLEVMRDKELNLRTDIYEILLQDEL 1093 >ref|XP_022766812.1| protein NRDE2 homolog isoform X4 [Durio zibethinus] Length = 1136 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEM 134 WLDGF KL+S+LTAKELSDLLEVMRDKELN+RTD+YEILLQDE+ Sbjct: 1091 WLDGFLKLNSILTAKELSDLLEVMRDKELNLRTDIYEILLQDEL 1134 >gb|PIN25545.1| hypothetical protein CDL12_01738 [Handroanthus impetiginosus] Length = 1161 Score = 82.0 bits (201), Expect = 2e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL+SVLT KELSDL EVMRDKELN+RTD+YEILLQDEMD Sbjct: 1116 WLDGFLKLNSVLTVKELSDLQEVMRDKELNLRTDIYEILLQDEMD 1160 >ref|XP_022766793.1| protein NRDE2 homolog isoform X2 [Durio zibethinus] Length = 1165 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEM 134 WLDGF KL+S+LTAKELSDLLEVMRDKELN+RTD+YEILLQDE+ Sbjct: 1120 WLDGFLKLNSILTAKELSDLLEVMRDKELNLRTDIYEILLQDEL 1163 >emb|CDO98626.1| unnamed protein product [Coffea canephora] Length = 1166 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMDV 140 WLDGF +L+SVLTAKELSDL EVMRDKELN+RTD+YEILLQDEM++ Sbjct: 1121 WLDGFLRLNSVLTAKELSDLQEVMRDKELNLRTDIYEILLQDEMEI 1166 >ref|XP_022766784.1| protein NRDE2 homolog isoform X1 [Durio zibethinus] Length = 1169 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEM 134 WLDGF KL+S+LTAKELSDLLEVMRDKELN+RTD+YEILLQDE+ Sbjct: 1124 WLDGFLKLNSILTAKELSDLLEVMRDKELNLRTDIYEILLQDEL 1167 >gb|PKI53450.1| hypothetical protein CRG98_026140 [Punica granatum] Length = 182 Score = 78.2 bits (191), Expect = 3e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDE 131 WLDGF KLSSVLT KELSDL EVMRDKELN+RTD+YEILLQDE Sbjct: 137 WLDGFHKLSSVLTPKELSDLQEVMRDKELNLRTDIYEILLQDE 179 >gb|PAN08475.1| hypothetical protein PAHAL_G02682 [Panicum hallii] gb|PAN08476.1| hypothetical protein PAHAL_G02682 [Panicum hallii] Length = 1154 Score = 81.3 bits (199), Expect = 4e-15 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KLSSVLT KELSDL EVMRDKELN+RTD+YEILLQDE D Sbjct: 1109 WLDGFLKLSSVLTLKELSDLQEVMRDKELNIRTDIYEILLQDETD 1153 >ref|XP_011072028.1| protein NRDE2 homolog [Sesamum indicum] Length = 1154 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL S+LT KELSDL EVMRDKELN+RTD+YEILLQDEMD Sbjct: 1109 WLDGFLKLDSILTVKELSDLQEVMRDKELNLRTDIYEILLQDEMD 1153 >gb|PHU23431.1| hypothetical protein BC332_08538 [Capsicum chinense] Length = 449 Score = 80.9 bits (198), Expect = 4e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL+SVLTAKELSDL EVMRDKELN+RTD+YEILLQD++D Sbjct: 404 WLDGFIKLNSVLTAKELSDLQEVMRDKELNLRTDIYEILLQDDVD 448 >ref|XP_016563949.1| PREDICTED: protein NRDE2 homolog isoform X3 [Capsicum annuum] Length = 994 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL+SVLTAKELSDL EVMRDKELN+RTD+YEILLQD++D Sbjct: 949 WLDGFIKLNSVLTAKELSDLQEVMRDKELNLRTDIYEILLQDDVD 993 >ref|XP_012704665.1| protein NRDE2 homolog [Setaria italica] gb|KQL31719.1| hypothetical protein SETIT_016143mg [Setaria italica] Length = 1150 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KLSS+LT KELSDL EVMRDKELN+RTD+YEILLQDE D Sbjct: 1105 WLDGFQKLSSILTLKELSDLQEVMRDKELNIRTDIYEILLQDETD 1149 >gb|PHT53487.1| hypothetical protein CQW23_07949 [Capsicum baccatum] Length = 1180 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL+SVLTAKELSDL EVMRDKELN+RTD+YEILLQD++D Sbjct: 1135 WLDGFIKLNSVLTAKELSDLQEVMRDKELNLRTDIYEILLQDDVD 1179 >ref|XP_016563947.1| PREDICTED: protein NRDE2 homolog isoform X1 [Capsicum annuum] Length = 1180 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL+SVLTAKELSDL EVMRDKELN+RTD+YEILLQD++D Sbjct: 1135 WLDGFIKLNSVLTAKELSDLQEVMRDKELNLRTDIYEILLQDDVD 1179 >gb|PHT87821.1| hypothetical protein T459_09927 [Capsicum annuum] Length = 1193 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEMD 137 WLDGF KL+SVLTAKELSDL EVMRDKELN+RTD+YEILLQD++D Sbjct: 1135 WLDGFIKLNSVLTAKELSDLQEVMRDKELNLRTDIYEILLQDDVD 1179 >emb|CAN63561.1| hypothetical protein VITISV_008646 [Vitis vinifera] Length = 166 Score = 77.0 bits (188), Expect = 5e-15 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 3 WLDGFTKLSSVLTAKELSDLLEVMRDKELNVRTDVYEILLQDEM 134 WLDGF KL SVL+AKE+SDL EVMRDKELNVRTD+YEILLQD++ Sbjct: 121 WLDGFQKLKSVLSAKEMSDLQEVMRDKELNVRTDIYEILLQDDV 164