BLASTX nr result
ID: Chrysanthemum21_contig00037067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00037067 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH98675.1| Myc-type, basic helix-loop-helix (bHLH) domain-co... 67 2e-10 >gb|KVH98675.1| Myc-type, basic helix-loop-helix (bHLH) domain-containing protein [Cynara cardunculus var. scolymus] Length = 324 Score = 67.0 bits (162), Expect = 2e-10 Identities = 43/102 (42%), Positives = 54/102 (52%), Gaps = 11/102 (10%) Frame = +2 Query: 5 FGFQHRRNIPYSGNTLSPNTINMNLPMFAFSASNPEEPCDWFNGLT---PMAKSILKQQL 175 FG +H+ N+P GNT N P+FAF+ S PEEPC WF+GL P ILK+QL Sbjct: 28 FGLRHQLNVPSFGNTTDENP-----PVFAFAESKPEEPCGWFHGLPRCHPEVNPILKEQL 82 Query: 176 PEPQASKPQE------PCDWFNGLTPMV-KSIPIQ-QLPEPQ 277 P P + E D N T ++ S PIQ LP+PQ Sbjct: 83 PVPGSRATHEIQKKFLVFDQSNDRTTLIYSSAPIQYHLPKPQ 124