BLASTX nr result
ID: Chrysanthemum21_contig00036579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00036579 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023752642.1| uncharacterized protein LOC111901007 [Lactuc... 55 5e-06 >ref|XP_023752642.1| uncharacterized protein LOC111901007 [Lactuca sativa] gb|PLY93926.1| hypothetical protein LSAT_1X127421 [Lactuca sativa] Length = 311 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 2/70 (2%) Frame = +2 Query: 116 KVRNKIPL*VLLEQNADIHKGIRFTGEGTVASINTARDWFYTPCTQCTGKSEKRHKTVKC 295 K RN+ PL LL QN + G +FT + ++ SI+ ++ WFY C +C K +KR T+ C Sbjct: 92 KKRNRFPLVDLLSQNPNA--GAQFTCKASLVSIDASKGWFYKACHECRKKLQKRGNTLAC 149 Query: 296 TEHG--AQPN 319 +H A+PN Sbjct: 150 EDHDQVAKPN 159