BLASTX nr result
ID: Chrysanthemum21_contig00036410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00036410 (674 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ENH78087.1| hypothetical protein Cob_12251 [Colletotrichum or... 55 3e-06 >gb|ENH78087.1| hypothetical protein Cob_12251 [Colletotrichum orbiculare MAFF 240422] Length = 119 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 8/84 (9%) Frame = -1 Query: 584 TCVPGAPVPKGQSN-VANWARLPSGTWVASFVDGYASHS-PAGRSSKGVLQIVNNSPNRW 411 TC+ GAPVP ++ ++RLP+G VA+F G+ S++ P+ S GVL+I NNS RW Sbjct: 22 TCLGGAPVPPLETRKFYPFSRLPNGIDVATFDGGFVSYAAPSINSKNGVLEITNNS--RW 79 Query: 410 SVYIAP------DTYWLDPGKSCK 357 I P + YW++ SCK Sbjct: 80 KKIICPVDEDLSECYWINAHDSCK 103