BLASTX nr result
ID: Chrysanthemum21_contig00036372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00036372 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10715.1| hypothetical protein Ccrd_010879 [Cynara carduncu... 57 3e-07 ref|XP_023769670.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 54 6e-06 >gb|KVI10715.1| hypothetical protein Ccrd_010879 [Cynara cardunculus var. scolymus] Length = 240 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 151 VAGPVLQGPNFRGTVSGERSFATKHSFSTDK 243 VAG LQGPNF GT+SG RSFATKHSFSTDK Sbjct: 46 VAGQALQGPNFHGTISGARSFATKHSFSTDK 76 >ref|XP_023769670.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial-like [Lactuca sativa] gb|PLY80970.1| hypothetical protein LSAT_9X108541 [Lactuca sativa] Length = 228 Score = 53.5 bits (127), Expect = 6e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 145 MAVAGPVLQGPNFRGTVSGERSFATKHSFSTDK 243 + VAG VLQGPN TVSG RSFATKHSFSTDK Sbjct: 18 LTVAGQVLQGPNICETVSGARSFATKHSFSTDK 50