BLASTX nr result
ID: Chrysanthemum21_contig00036207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00036207 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023763908.1| uncharacterized protein LOC111912403 [Lactuc... 60 9e-08 ref|XP_021982929.1| uncharacterized protein LOC110878857 [Helian... 57 8e-07 >ref|XP_023763908.1| uncharacterized protein LOC111912403 [Lactuca sativa] gb|PLY85419.1| hypothetical protein LSAT_4X148020 [Lactuca sativa] Length = 752 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 98 MGNLKDFLQVLCIATADTKLDELLYLSESIRS 3 MGNLKDFLQV CI TADTKLDELL+LSES+RS Sbjct: 1 MGNLKDFLQVFCIGTADTKLDELLFLSESVRS 32 >ref|XP_021982929.1| uncharacterized protein LOC110878857 [Helianthus annuus] gb|OTG15514.1| hypothetical protein HannXRQ_Chr09g0261191 [Helianthus annuus] Length = 748 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 98 MGNLKDFLQVLCIATADTKLDELLYLSESIRS 3 MGNLKDFLQV CIATADTK +ELL+LSES+RS Sbjct: 1 MGNLKDFLQVFCIATADTKHEELLFLSESVRS 32