BLASTX nr result
ID: Chrysanthemum21_contig00036092
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00036092 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023750033.1| DExH-box ATP-dependent RNA helicase DExH3 [L... 59 5e-07 gb|KVH88219.1| hypothetical protein Ccrd_024391 [Cynara carduncu... 58 8e-07 >ref|XP_023750033.1| DExH-box ATP-dependent RNA helicase DExH3 [Lactuca sativa] gb|PLY95889.1| hypothetical protein LSAT_5X36980 [Lactuca sativa] Length = 1158 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 7 SGNADSLVDGSLMEKVFERRSLQMRNMQRAWE 102 +GN DSLVDGSLMEKV +RRSLQMRNMQR+WE Sbjct: 216 NGNPDSLVDGSLMEKVLQRRSLQMRNMQRSWE 247 >gb|KVH88219.1| hypothetical protein Ccrd_024391 [Cynara cardunculus var. scolymus] Length = 293 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 10 GNADSLVDGSLMEKVFERRSLQMRNMQRAWE 102 G+ DSLVDGSLMEKV +RRSLQMRNMQRAWE Sbjct: 199 GHPDSLVDGSLMEKVLQRRSLQMRNMQRAWE 229