BLASTX nr result
ID: Chrysanthemum21_contig00036001
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00036001 (729 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88997.1| Nucleotide-binding, alpha-beta plait, partial [Cy... 69 5e-10 >gb|KVH88997.1| Nucleotide-binding, alpha-beta plait, partial [Cynara cardunculus var. scolymus] Length = 349 Score = 69.3 bits (168), Expect = 5e-10 Identities = 55/124 (44%), Positives = 63/124 (50%), Gaps = 11/124 (8%) Frame = +3 Query: 387 KELLPCL-SLYSLMSSFYINYTRXXXXXXXXXXXXXXXX----YHVMPSITNPEGVMLYH 551 + L CL S YS M SFYI++ R YH MPSIT P+GVM Sbjct: 2 ENLSACLPSFYSQMESFYISFIRSYHSLASLPAISQGLSWWDLYHAMPSITYPKGVM--- 58 Query: 552 AMSSISEHVLSEL*SILSN------TISDLTHGFNLI*FHHRDLLDLARPLHLHPYVHQM 713 +SI L L + N ISDL G N+I FHH DLLDLAR LHPYVHQ+ Sbjct: 59 --NSILP-CLPFLNTCCQNGEPCLAVISDLRLGLNVILFHHHDLLDLAR--LLHPYVHQL 113 Query: 714 FSYL 725 FS L Sbjct: 114 FSCL 117