BLASTX nr result
ID: Chrysanthemum21_contig00035699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035699 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022011679.1| uncharacterized protein LOC110911379 [Helian... 57 1e-06 >ref|XP_022011679.1| uncharacterized protein LOC110911379 [Helianthus annuus] gb|OTF94839.1| hypothetical protein HannXRQ_Chr15g0476491 [Helianthus annuus] Length = 884 Score = 57.0 bits (136), Expect = 1e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 199 LTWM*RLVLEFHCSQCQAITAAKQLDAFASNKHFYDDCFKATLQ 68 LT M R +LE H SQCQAI AAK+LDA AS+KHF DD +ATLQ Sbjct: 641 LTRMWRSMLECHRSQCQAIGAAKRLDAIASSKHFSDDSLEATLQ 684