BLASTX nr result
ID: Chrysanthemum21_contig00035541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035541 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021998559.1| uncharacterized protein LOC110895543 isoform... 60 8e-08 ref|XP_021998558.1| uncharacterized protein LOC110895543 isoform... 60 8e-08 ref|XP_023734179.1| uncharacterized protein LOC111882041 [Lactuc... 58 5e-07 >ref|XP_021998559.1| uncharacterized protein LOC110895543 isoform X2 [Helianthus annuus] Length = 498 Score = 60.5 bits (145), Expect = 8e-08 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +1 Query: 1 ANRPQREEVFAKITSKIKGKCNVKLCRDDHAIVDVPSRNITQV 129 ANRPQREEVFAKI SKIK KCN KLCRDD + + IT+V Sbjct: 456 ANRPQREEVFAKIASKIKSKCNGKLCRDDRTVHVSSTNQITEV 498 >ref|XP_021998558.1| uncharacterized protein LOC110895543 isoform X1 [Helianthus annuus] gb|OTG05804.1| hypothetical protein HannXRQ_Chr12g0377701 [Helianthus annuus] Length = 563 Score = 60.5 bits (145), Expect = 8e-08 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +1 Query: 1 ANRPQREEVFAKITSKIKGKCNVKLCRDDHAIVDVPSRNITQV 129 ANRPQREEVFAKI SKIK KCN KLCRDD + + IT+V Sbjct: 521 ANRPQREEVFAKIASKIKSKCNGKLCRDDRTVHVSSTNQITEV 563 >ref|XP_023734179.1| uncharacterized protein LOC111882041 [Lactuca sativa] gb|PLY73505.1| hypothetical protein LSAT_4X15400 [Lactuca sativa] Length = 555 Score = 58.2 bits (139), Expect = 5e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 ANRPQREEVFAKITSKIKGKCNVKLCRDD 87 ANRPQREEVFAKITSKIKGKCN KLCR D Sbjct: 519 ANRPQREEVFAKITSKIKGKCNGKLCRGD 547