BLASTX nr result
ID: Chrysanthemum21_contig00035493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035493 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023755592.1| pentatricopeptide repeat-containing protein ... 57 7e-07 >ref|XP_023755592.1| pentatricopeptide repeat-containing protein At5g62370 [Lactuca sativa] ref|XP_023755593.1| pentatricopeptide repeat-containing protein At5g62370 [Lactuca sativa] gb|PLY91666.1| hypothetical protein LSAT_8X8880 [Lactuca sativa] Length = 993 Score = 57.4 bits (137), Expect = 7e-07 Identities = 33/61 (54%), Positives = 39/61 (63%), Gaps = 9/61 (14%) Frame = -1 Query: 248 MNKNNK--HKPHNLIASILKSLTKSFTTTPL*-------KPISTVTPCQQDHKSLCFYLA 96 M KNN+ HKPH L S KS+ KSF T+PL STVTPC++DH+SLCF LA Sbjct: 1 MIKNNRIHHKPH-LFKSFFKSIRKSFATSPLPLSDPSSGPSFSTVTPCEEDHRSLCFSLA 59 Query: 95 E 93 E Sbjct: 60 E 60