BLASTX nr result
ID: Chrysanthemum21_contig00035399
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035399 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG31196.1| putative reverse transcriptase domain-containing ... 65 2e-14 gb|OTG37047.1| putative reverse transcriptase domain-containing ... 66 6e-14 gb|OTF84672.1| putative reverse transcriptase domain-containing ... 61 6e-14 gb|OTG24837.1| putative reverse transcriptase domain-containing ... 61 6e-14 gb|OTF91502.1| putative reverse transcriptase domain-containing ... 61 6e-14 gb|OTF88227.1| putative reverse transcriptase domain-containing ... 61 6e-14 gb|OTG34595.1| putative reverse transcriptase domain-containing ... 61 6e-14 gb|OTF84695.1| putative reverse transcriptase domain-containing ... 61 6e-14 gb|OTG27877.1| putative reverse transcriptase domain, Ribonuclea... 65 6e-14 gb|OTG19951.1| putative reverse transcriptase domain-containing ... 65 8e-14 gb|OTG05417.1| putative reverse transcriptase domain-containing ... 65 1e-13 gb|OTG33348.1| putative reverse transcriptase domain-containing ... 61 2e-13 gb|OTG27723.1| putative reverse transcriptase domain-containing ... 59 2e-13 gb|OTG06580.1| putative reverse transcriptase domain-containing ... 64 2e-13 gb|OTG20164.1| putative reverse transcriptase domain-containing ... 59 2e-13 gb|OTG01228.1| putative reverse transcriptase domain-containing ... 65 3e-13 gb|OTG36301.1| putative reverse transcriptase domain-containing ... 59 3e-13 ref|XP_023770037.1| uncharacterized protein LOC111918635 [Lactuc... 63 3e-13 gb|OTG05643.1| putative reverse transcriptase domain-containing ... 62 4e-13 gb|OTG09789.1| putative reverse transcriptase domain-containing ... 59 4e-13 >gb|OTG31196.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1509 Score = 65.1 bits (157), Expect(2) = 2e-14 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 ID+KL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 1417 IDDKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 1452 Score = 41.6 bits (96), Expect(2) = 2e-14 Identities = 19/39 (48%), Positives = 26/39 (66%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNSE*NPGRVSSEA 227 + GPEFTWERED + KYP LF T + P ++++EA Sbjct: 1453 RRGPEFTWEREDQMKLKYPHLFPT---DQAEPSKLNAEA 1488 >gb|OTG37047.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1585 Score = 66.2 bits (160), Expect(2) = 6e-14 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDEKL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 1494 IDEKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 1529 Score = 38.5 bits (88), Expect(2) = 6e-14 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLF 176 + GPEFTWERED + KYP LF Sbjct: 1530 RRGPEFTWEREDQMKLKYPHLF 1551 >gb|OTF84672.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1515 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1424 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1459 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1460 QRGPEYTWEREDQMKEKYPQLFETNAST 1487 >gb|OTG24837.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1513 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1422 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1457 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1458 QRGPEYTWEREDQMKEKYPQLFETNAST 1485 >gb|OTF91502.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1503 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1412 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1447 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1448 QRGPEYTWEREDQMKEKYPQLFETNAST 1475 >gb|OTF88227.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1503 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1412 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1447 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1448 QRGPEYTWEREDQMKEKYPQLFETNAST 1475 >gb|OTG34595.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1500 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1409 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1444 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1445 QRGPEYTWEREDQMKEKYPQLFETNAST 1472 >gb|OTF84695.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1497 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1406 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1441 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1442 QRGPEYTWEREDQMKEKYPQLFETNAST 1469 >gb|OTG27877.1| putative reverse transcriptase domain, Ribonuclease H-like domain protein [Helianthus annuus] Length = 1051 Score = 65.1 bits (157), Expect(2) = 6e-14 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 ID+KL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 955 IDDKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 990 Score = 39.7 bits (91), Expect(2) = 6e-14 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMT 182 + GPEFTWERED + KYP LF T Sbjct: 991 RRGPEFTWEREDQMKLKYPHLFPT 1014 >gb|OTG19951.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1511 Score = 65.1 bits (157), Expect(2) = 8e-14 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 ID+KL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 1415 IDDKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 1450 Score = 39.3 bits (90), Expect(2) = 8e-14 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLF 176 + GPEFTWERED +KYP LF Sbjct: 1451 RRGPEFTWEREDQMERKYPHLF 1472 >gb|OTG05417.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1587 Score = 65.1 bits (157), Expect(2) = 1e-13 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 ID+KL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 1498 IDDKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 1533 Score = 38.5 bits (88), Expect(2) = 1e-13 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLF 176 + GPEFTWERED + KYP LF Sbjct: 1534 RRGPEFTWEREDQMKLKYPHLF 1555 >gb|OTG33348.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1500 Score = 61.2 bits (147), Expect(2) = 2e-13 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1409 IDERLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1444 Score = 42.0 bits (97), Expect(2) = 2e-13 Identities = 15/28 (53%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWER+D ++KYP+LF T++++ Sbjct: 1445 QRGPEYTWERKDQMKEKYPQLFETNAST 1472 >gb|OTG27723.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1458 Score = 58.9 bits (141), Expect(2) = 2e-13 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LK SRIP+++VRWNS Sbjct: 1364 IDEQLKFVEEPVEITDRDVKVLKSSRIPLVRVRWNS 1399 Score = 44.3 bits (103), Expect(2) = 2e-13 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 + GPEFTWERED ++KYP+LF S+N+ Sbjct: 1400 RRGPEFTWEREDRMKQKYPQLFKNSTNA 1427 >gb|OTG06580.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1588 Score = 64.3 bits (155), Expect(2) = 2e-13 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 +D+KL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 1497 LDDKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 1532 Score = 38.5 bits (88), Expect(2) = 2e-13 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLF 176 + GPEFTWERED + KYP LF Sbjct: 1533 RRGPEFTWEREDQMKLKYPHLF 1554 >gb|OTG20164.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1486 Score = 58.9 bits (141), Expect(2) = 2e-13 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LK SRIP+++VRWNS Sbjct: 1392 IDEQLKFVEEPVEITDRDVKVLKSSRIPLVRVRWNS 1427 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 + GPEFTWERED ++KYP+LF S+N+ Sbjct: 1428 RRGPEFTWEREDRMKQKYPQLFENSTNA 1455 >gb|OTG01228.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1516 Score = 65.1 bits (157), Expect(2) = 3e-13 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 ID+KL FVEEPIEIMDRE+K KHSRIPI++VRWNS Sbjct: 1420 IDDKLQFVEEPIEIMDREVKVRKHSRIPIVRVRWNS 1455 Score = 37.4 bits (85), Expect(2) = 3e-13 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLF 176 + GPEFTWERED + +YP LF Sbjct: 1456 RRGPEFTWEREDQMKLRYPHLF 1477 >gb|OTG36301.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1488 Score = 58.5 bits (140), Expect(2) = 3e-13 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L FVEEP+EI DR++K LK++RIP+++VRWNS Sbjct: 1394 IDEQLKFVEEPVEITDRDVKVLKNTRIPLVRVRWNS 1429 Score = 43.9 bits (102), Expect(2) = 3e-13 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 + GPEFTWERED ++KYP+LF S+N+ Sbjct: 1430 RRGPEFTWEREDRMKQKYPQLFENSTNA 1457 >ref|XP_023770037.1| uncharacterized protein LOC111918635 [Lactuca sativa] Length = 396 Score = 62.8 bits (151), Expect(2) = 3e-13 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 I++KLNFVEEPIEI+D E+K+LK S+IPI+KVRWNS Sbjct: 333 INDKLNFVEEPIEILDMEVKQLKRSKIPIVKVRWNS 368 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLF 176 + GPE+TWERED ++KYP+LF Sbjct: 369 KRGPEYTWEREDFMKEKYPQLF 390 >gb|OTG05643.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1512 Score = 61.6 bits (148), Expect(2) = 4e-13 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 IDE+L+F EEPIEIMDREIK LK S+IP+++VRWNS Sbjct: 1436 IDEQLHFTEEPIEIMDREIKTLKRSQIPLVRVRWNS 1471 Score = 40.4 bits (93), Expect(2) = 4e-13 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 + GPEFTWERED + KYP+LF + S Sbjct: 1472 RRGPEFTWEREDQMKSKYPQLFPNENPS 1499 >gb|OTG09789.1| putative reverse transcriptase domain-containing protein [Helianthus annuus] Length = 1500 Score = 58.5 bits (140), Expect(2) = 4e-13 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 2 IDEKLNFVEEPIEIMDREIKRLKHSRIPIIKVRWNS 109 ID +L FVEEP+EI DR++K LKH RIP+++VRWNS Sbjct: 1409 IDGRLQFVEEPVEITDRDVKVLKHKRIPLVRVRWNS 1444 Score = 43.5 bits (101), Expect(2) = 4e-13 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 111 QHGPEFTWEREDVFRKKYPKLFMTSSNS 194 Q GPE+TWERED ++KYP+LF T++++ Sbjct: 1445 QRGPEYTWEREDQMKEKYPQLFETNAST 1472