BLASTX nr result
ID: Chrysanthemum21_contig00035398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035398 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|SOC39879.1| hypothetical protein SAMN05877842_106167 [Lysini... 59 3e-07 >emb|SOC39879.1| hypothetical protein SAMN05877842_106167 [Lysinibacillus acetophenoni] Length = 349 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/60 (46%), Positives = 35/60 (58%) Frame = +3 Query: 327 NKKRITCDSTIITCDSVI*ESHVIHLESHVIHHKITCDSEQITCDS*QITCDSQKITCDF 506 + + TCDST ITCD + + +TCDS Q+TCDS Q+TCDS ITCDF Sbjct: 40 DSRTFTCDSTWITCDF---REFICEFPELICESGVTCDSPQLTCDSPQLTCDSTWITCDF 96