BLASTX nr result
ID: Chrysanthemum21_contig00035376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035376 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772958.1| granule-bound starch synthase 2, chloroplast... 68 1e-10 gb|KVI09154.1| hypothetical protein Ccrd_012514, partial [Cynara... 58 1e-07 ref|XP_022005511.1| granule-bound starch synthase 2, chloroplast... 59 2e-07 ref|XP_022005510.1| granule-bound starch synthase 2, chloroplast... 59 2e-07 >ref|XP_023772958.1| granule-bound starch synthase 2, chloroplastic/amyloplastic [Lactuca sativa] gb|PLY78440.1| hypothetical protein LSAT_2X88360 [Lactuca sativa] Length = 736 Score = 68.2 bits (165), Expect = 1e-10 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 2/94 (2%) Frame = -3 Query: 291 DSNLPDDIFTLDGPTTSSVAPLEYQVPDATSKRYDEDSSKSSINLPPKSYQNGDTANKPQ 112 DSNLPDDI+TL P+T K Y+ D+SKS I KS+ + D NK Q Sbjct: 141 DSNLPDDIYTLQNPSTI--------------KSYEIDTSKSQI----KSFPDEDFNNKLQ 182 Query: 111 STPSKKAITHV--LPPFVSEISPTYKNLEVKNES 16 +T S+KA T+ LPPFVS+IS T+K E NES Sbjct: 183 NTNSEKATTNTKELPPFVSDISSTFKKFENTNES 216 >gb|KVI09154.1| hypothetical protein Ccrd_012514, partial [Cynara cardunculus var. scolymus] Length = 183 Score = 58.2 bits (139), Expect = 1e-07 Identities = 36/87 (41%), Positives = 46/87 (52%) Frame = -3 Query: 408 LQQIAERRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXERDSNLPDDIFTLDGPTTSSVAP 229 LQQIAERRD DSNLPDD +T D P++SSV P Sbjct: 101 LQQIAERRDIITSINNTTINSEIEEISSKEEESFLEL--DSNLPDDNYTADNPSSSSVDP 158 Query: 228 LEYQVPDATSKRYDEDSSKSSINLPPK 148 ++Y +PD + YDE++S+S INLP K Sbjct: 159 VKYPLPD--NLHYDEEASESGINLPRK 183 >ref|XP_022005511.1| granule-bound starch synthase 2, chloroplastic/amyloplastic-like isoform X2 [Helianthus annuus] Length = 621 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/63 (47%), Positives = 39/63 (61%) Frame = -3 Query: 189 DEDSSKSSINLPPKSYQNGDTANKPQSTPSKKAITHVLPPFVSEISPTYKNLEVKNESNI 10 D+D+ KS + LPPKSY + D K T S+KA + LPPFVSE S TYK+ NE + Sbjct: 45 DDDTLKSGMKLPPKSYLDSDFKEKLHGTSSEKATRYELPPFVSEFSTTYKSSIETNEPTL 104 Query: 9 PNV 1 +V Sbjct: 105 HHV 107 >ref|XP_022005510.1| granule-bound starch synthase 2, chloroplastic/amyloplastic-like isoform X1 [Helianthus annuus] gb|OTF98816.1| putative granule-bound starch synthase 2, chloroplastic/amyloplastic [Helianthus annuus] Length = 739 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/63 (47%), Positives = 39/63 (61%) Frame = -3 Query: 189 DEDSSKSSINLPPKSYQNGDTANKPQSTPSKKAITHVLPPFVSEISPTYKNLEVKNESNI 10 D+D+ KS + LPPKSY + D K T S+KA + LPPFVSE S TYK+ NE + Sbjct: 163 DDDTLKSGMKLPPKSYLDSDFKEKLHGTSSEKATRYELPPFVSEFSTTYKSSIETNEPTL 222 Query: 9 PNV 1 +V Sbjct: 223 HHV 225