BLASTX nr result
ID: Chrysanthemum21_contig00035320
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035320 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023738592.1| mitogen-activated protein kinase homolog NTF... 101 3e-22 gb|EPS64079.1| hypothetical protein M569_10702, partial [Genlise... 98 1e-21 ref|XP_021970136.1| mitogen-activated protein kinase homolog NTF... 100 1e-21 gb|KVI12015.1| Mitogen-activated protein (MAP) kinase, conserved... 100 2e-21 ref|XP_003606525.2| MAP kinase [Medicago truncatula] >gi|6573880... 95 2e-21 ref|XP_023734732.1| mitogen-activated protein kinase homolog NTF... 97 4e-21 gb|KVH94584.1| Mitogen-activated protein (MAP) kinase, conserved... 98 6e-21 gb|PKI31190.1| hypothetical protein CRG98_048436 [Punica granatum] 96 7e-21 ref|XP_021977964.1| mitogen-activated protein kinase homolog NTF... 98 7e-21 gb|PIA38752.1| hypothetical protein AQUCO_02700155v1 [Aquilegia ... 96 8e-21 gb|PLY73118.1| hypothetical protein LSAT_9X21161 [Lactuca sativa] 97 1e-20 ref|XP_023734730.1| mitogen-activated protein kinase homolog NTF... 97 1e-20 ref|XP_020594807.1| mitogen-activated protein kinase homolog MMK... 92 1e-20 gb|PNX95547.1| mitogen-activated protein kinase NTF6-like protei... 95 2e-20 ref|XP_018723153.1| PREDICTED: mitogen-activated protein kinase ... 95 2e-20 ref|XP_015874151.1| PREDICTED: mitogen-activated protein kinase ... 96 2e-20 gb|AAS55705.1| NTF6, partial [Nicotiana benthamiana] 92 3e-20 gb|OTG22324.1| putative protein kinase-like domain-containing pr... 92 3e-20 gb|PIA38751.1| hypothetical protein AQUCO_02700155v1 [Aquilegia ... 96 3e-20 ref|XP_003538034.1| PREDICTED: mitogen-activated protein kinase ... 96 4e-20 >ref|XP_023738592.1| mitogen-activated protein kinase homolog NTF6-like [Lactuca sativa] gb|PLY70073.1| hypothetical protein LSAT_8X76340 [Lactuca sativa] Length = 381 Score = 101 bits (252), Expect = 3e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD Sbjct: 202 TEYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 249 >gb|EPS64079.1| hypothetical protein M569_10702, partial [Genlisea aurea] Length = 255 Score = 97.8 bits (242), Expect = 1e-21 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT+AIDIWSVGC+LMEI LREPLFPGKD Sbjct: 197 TEYVVTRWYRAPELLLNCSEYTSAIDIWSVGCVLMEIILREPLFPGKD 244 >ref|XP_021970136.1| mitogen-activated protein kinase homolog NTF6-like [Helianthus annuus] gb|OTG22806.1| putative mitogen-activated kinase [Helianthus annuus] Length = 379 Score = 99.8 bits (247), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCILMEIALREPLFPGKD Sbjct: 200 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIALREPLFPGKD 247 >gb|KVI12015.1| Mitogen-activated protein (MAP) kinase, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 395 Score = 99.8 bits (247), Expect = 2e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEI LREPLFPGKD Sbjct: 218 TEYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIILREPLFPGKD 265 >ref|XP_003606525.2| MAP kinase [Medicago truncatula] gb|AES88722.2| MAP kinase [Medicago truncatula] Length = 166 Score = 95.1 bits (235), Expect = 2e-21 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AID+WSVGCILMEI REPLFPGKD Sbjct: 2 TEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILMEIIRREPLFPGKD 49 >ref|XP_023734732.1| mitogen-activated protein kinase homolog NTF6-like isoform X2 [Lactuca sativa] Length = 301 Score = 97.4 bits (241), Expect = 4e-21 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AID+WSVGCILMEI LREPLFPGKD Sbjct: 200 TEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILMEILLREPLFPGKD 247 >gb|KVH94584.1| Mitogen-activated protein (MAP) kinase, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 364 Score = 97.8 bits (242), Expect = 6e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCILMEI LREPLFPGKD Sbjct: 200 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEILLREPLFPGKD 247 >gb|PKI31190.1| hypothetical protein CRG98_048436 [Punica granatum] Length = 255 Score = 95.9 bits (237), Expect = 7e-21 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCILMEI REPLFPGKD Sbjct: 75 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIITREPLFPGKD 122 >ref|XP_021977964.1| mitogen-activated protein kinase homolog NTF6-like [Helianthus annuus] gb|OTG19087.1| putative serine/threonine-protein kinase, SIK1/2 [Helianthus annuus] Length = 378 Score = 97.8 bits (242), Expect = 7e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCILMEI LREPLFPGKD Sbjct: 200 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIILREPLFPGKD 247 >gb|PIA38752.1| hypothetical protein AQUCO_02700155v1 [Aquilegia coerulea] Length = 265 Score = 95.9 bits (237), Expect = 8e-21 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYTTAIDIWSVGCI MEI REPLFPGKD Sbjct: 192 TEYVVTRWYRAPELLLNCSEYTTAIDIWSVGCIFMEIIKREPLFPGKD 239 >gb|PLY73118.1| hypothetical protein LSAT_9X21161 [Lactuca sativa] Length = 372 Score = 97.4 bits (241), Expect = 1e-20 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AID+WSVGCILMEI LREPLFPGKD Sbjct: 195 TEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILMEILLREPLFPGKD 242 >ref|XP_023734730.1| mitogen-activated protein kinase homolog NTF6-like isoform X1 [Lactuca sativa] Length = 377 Score = 97.4 bits (241), Expect = 1e-20 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AID+WSVGCILMEI LREPLFPGKD Sbjct: 200 TEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILMEILLREPLFPGKD 247 >ref|XP_020594807.1| mitogen-activated protein kinase homolog MMK2 [Phalaenopsis equestris] Length = 133 Score = 92.0 bits (227), Expect = 1e-20 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCIL EI REPLFPG+D Sbjct: 75 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIVTREPLFPGRD 122 >gb|PNX95547.1| mitogen-activated protein kinase NTF6-like protein, partial [Trifolium pratense] Length = 267 Score = 95.1 bits (235), Expect = 2e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AID+WSVGCILMEI REPLFPGKD Sbjct: 198 TEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILMEILRREPLFPGKD 245 >ref|XP_018723153.1| PREDICTED: mitogen-activated protein kinase 4-like, partial [Eucalyptus grandis] Length = 249 Score = 94.7 bits (234), Expect = 2e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCIL EIA REPLFPGKD Sbjct: 191 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIATREPLFPGKD 238 >ref|XP_015874151.1| PREDICTED: mitogen-activated protein kinase homolog NTF6-like [Ziziphus jujuba] Length = 311 Score = 95.5 bits (236), Expect = 2e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCILMEI REPLFPGKD Sbjct: 135 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIIRREPLFPGKD 182 >gb|AAS55705.1| NTF6, partial [Nicotiana benthamiana] Length = 178 Score = 92.4 bits (228), Expect = 3e-20 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNC+EYT AIDIWSVGCILME+ REPLFPG+D Sbjct: 11 TEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILMELIKREPLFPGRD 58 >gb|OTG22324.1| putative protein kinase-like domain-containing protein [Helianthus annuus] Length = 156 Score = 91.7 bits (226), Expect = 3e-20 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCIL EI R+PLFPGKD Sbjct: 64 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEILTRQPLFPGKD 111 >gb|PIA38751.1| hypothetical protein AQUCO_02700155v1 [Aquilegia coerulea] Length = 366 Score = 95.9 bits (237), Expect = 3e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYTTAIDIWSVGCI MEI REPLFPGKD Sbjct: 192 TEYVVTRWYRAPELLLNCSEYTTAIDIWSVGCIFMEIIKREPLFPGKD 239 >ref|XP_003538034.1| PREDICTED: mitogen-activated protein kinase 13 [Glycine max] gb|KHN22022.1| Mitogen-activated protein kinase like NTF6 [Glycine soja] gb|KRG88717.1| hypothetical protein GLYMA_U034700 [Glycine max] Length = 373 Score = 95.9 bits (237), Expect = 4e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 302 SKYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKD 159 ++YVVTRWYRAPELLLNCSEYT AIDIWSVGCILMEI REPLFPGKD Sbjct: 196 TEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIVRREPLFPGKD 243