BLASTX nr result
ID: Chrysanthemum21_contig00035124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035124 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022028018.1| mitotic checkpoint protein BUB3.1 [Helianthu... 56 7e-06 gb|OTG30933.1| putative transducin/WD40 repeat-like superfamily ... 56 7e-06 >ref|XP_022028018.1| mitotic checkpoint protein BUB3.1 [Helianthus annuus] Length = 341 Score = 55.8 bits (133), Expect = 7e-06 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +3 Query: 408 YGVTLVEGRGSLESFYLPEGGLSKK----CHRKSEHVTDIVYSVNTIAFHHV 551 Y ++ VEGR ++E F L E G SKK CHRKSE DIVY VNTIAFH V Sbjct: 202 YALSSVEGRVAMEFFDLTEAGQSKKYAFKCHRKSEAGRDIVYPVNTIAFHPV 253 >gb|OTG30933.1| putative transducin/WD40 repeat-like superfamily protein [Helianthus annuus] Length = 380 Score = 55.8 bits (133), Expect = 7e-06 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +3 Query: 408 YGVTLVEGRGSLESFYLPEGGLSKK----CHRKSEHVTDIVYSVNTIAFHHV 551 Y ++ VEGR ++E F L E G SKK CHRKSE DIVY VNTIAFH V Sbjct: 241 YALSSVEGRVAMEFFDLTEAGQSKKYAFKCHRKSEAGRDIVYPVNTIAFHPV 292