BLASTX nr result
ID: Chrysanthemum21_contig00035051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00035051 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023925005.1| uncharacterized protein LOC112036443 [Quercu... 59 1e-07 ref|XP_010531594.1| PREDICTED: uncharacterized protein LOC104807... 58 5e-07 gb|PNX67439.1| gag-pol polyprotein, partial [Trifolium pratense] 56 1e-06 ref|XP_022897598.1| uncharacterized protein LOC111411283 [Olea e... 57 1e-06 ref|XP_023870462.1| uncharacterized protein LOC111983046 [Quercu... 55 2e-06 gb|PNX93845.1| gag-protease polyprotein, partial [Trifolium prat... 56 2e-06 gb|AAO73521.1| gag-pol polyprotein [Glycine max] 56 2e-06 gb|AAO73523.1| gag-pol polyprotein [Glycine max] 56 2e-06 gb|AAO73527.1| gag-pol polyprotein [Glycine max] 56 2e-06 gb|PNX57030.1| putative gag-pol polyprotein, partial [Trifolium ... 53 3e-06 gb|PNX92161.1| retrotransposon-related protein, partial [Trifoli... 55 3e-06 ref|XP_024163939.1| uncharacterized protein LOC112170894 [Rosa c... 55 3e-06 gb|PNY16758.1| gag-pol polyprotein [Trifolium pratense] 55 4e-06 gb|PNY10358.1| retrotransposon-related protein, partial [Trifoli... 55 4e-06 ref|XP_008229478.1| PREDICTED: uncharacterized protein LOC103328... 55 6e-06 gb|AAC64917.1| gag-pol polyprotein [Glycine max] 55 6e-06 gb|AAO73525.1| gag-pol polyprotein [Glycine max] 55 6e-06 gb|AAO73529.1| gag-pol polyprotein [Glycine max] 55 6e-06 ref|XP_023891352.1| wall-associated receptor kinase-like 10 [Que... 54 7e-06 gb|PNX66233.1| gag-pol polyprotein [Trifolium pratense] 52 7e-06 >ref|XP_023925005.1| uncharacterized protein LOC112036443 [Quercus suber] Length = 249 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPP 147 D GIF+GYS S+A+ VYN RT+K+MET+NV DE S+ SE+ + E P Sbjct: 109 DEGIFLGYSSTSKAYWVYNKRTKKVMETVNVVIDEASESGSEKFSEEIP 157 >ref|XP_010531594.1| PREDICTED: uncharacterized protein LOC104807865 [Tarenaya hassleriana] Length = 624 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEP 144 D GIF+GY++NS A+RVYN RT+ +ME+ NV FDE +Q + ++LEP Sbjct: 6 DEGIFLGYAQNSAAYRVYNLRTKTVMESANVIFDEETQRKVDSISLEP 53 >gb|PNX67439.1| gag-pol polyprotein, partial [Trifolium pratense] Length = 223 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/90 (33%), Positives = 47/90 (52%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPPLIPMASNQNRL 180 D GIF+GYS NSRA+RV+N RTR +ME+INV D+ +++ + P+A+ + Sbjct: 124 DEGIFLGYSTNSRAYRVFNSRTRTMMESINVVVDDADTTSADPAEETDVITPVAAPDDDQ 183 Query: 181 GPTPNQQTSGHISSRLIQQRAP*TVVDTPH 270 + Q S + + + P T H Sbjct: 184 AEPESNQNSESATENVRPNKGPSTRTQKNH 213 >ref|XP_022897598.1| uncharacterized protein LOC111411283 [Olea europaea var. sylvestris] Length = 1079 Score = 56.6 bits (135), Expect = 1e-06 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 13/81 (16%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINV-------------NFDELSQMASERLALE 141 D GIF+GYS NSRAFRVYN RTR +ME++NV N DE + S + Sbjct: 872 DEGIFLGYSRNSRAFRVYNLRTRVVMESVNVVIDDVVSEGESVENCDEDGDLISSN---D 928 Query: 142 PPLIPMASNQNRLGPTPNQQT 204 P IPM+ + + TP ++T Sbjct: 929 PTEIPMSESSLKKPETPEKKT 949 >ref|XP_023870462.1| uncharacterized protein LOC111983046 [Quercus suber] Length = 221 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPP--LIPMASNQ 171 D GIF+GYS S+ ++VYN RT K+MET+NV DE S +SE+ E P ++P+ S + Sbjct: 97 DEGIFLGYSSTSKDYQVYNKRTIKVMETVNVVIDESSNSSSEKGIEELPEEILPLKSRE 155 >gb|PNX93845.1| gag-protease polyprotein, partial [Trifolium pratense] Length = 1176 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASE 126 D GIF+GYS NSRA+RVYN RT+ +ME+INV D++S A E Sbjct: 837 DEGIFLGYSTNSRAYRVYNSRTKTMMESINVVIDDVSSEAVE 878 >gb|AAO73521.1| gag-pol polyprotein [Glycine max] Length = 1574 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELS 111 D GIF+GYS NSRA+RV+N RTR +ME+INV D+LS Sbjct: 941 DAGIFLGYSTNSRAYRVFNSRTRTVMESINVVVDDLS 977 >gb|AAO73523.1| gag-pol polyprotein [Glycine max] Length = 1576 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELS 111 D GIF+GYS NSRA+RV+N RTR +ME+INV D+LS Sbjct: 943 DAGIFLGYSTNSRAYRVFNSRTRTVMESINVVVDDLS 979 >gb|AAO73527.1| gag-pol polyprotein [Glycine max] Length = 1576 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELS 111 D GIF+GYS NSRA+RV+N RTR +ME+INV D+LS Sbjct: 943 DAGIFLGYSTNSRAYRVFNSRTRTVMESINVVVDDLS 979 >gb|PNX57030.1| putative gag-pol polyprotein, partial [Trifolium pratense] Length = 124 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPPLIPMAS-NQNR 177 D GIF+GYS NSRA+RV+N RTR +ME+INV D+ ++ + P+A+ N ++ Sbjct: 43 DEGIFLGYSTNSRAYRVFNYRTRTMMESINVVIDDTDTTNADPAEETDVITPVAAPNDDQ 102 Query: 178 LGPTPNQ 198 + P +Q Sbjct: 103 VEPESDQ 109 >gb|PNX92161.1| retrotransposon-related protein, partial [Trifolium pratense] Length = 1303 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +1 Query: 7 GIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPPLIPMAS 165 GIF+GYS N+RA+RVYN RT+ I+E+INV D+ + + L P +P AS Sbjct: 674 GIFLGYSSNNRAYRVYNNRTKVIIESINVVVDDAPIAMTHDVPLAAPSVPQAS 726 >ref|XP_024163939.1| uncharacterized protein LOC112170894 [Rosa chinensis] Length = 1350 Score = 55.5 bits (132), Expect = 3e-06 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPPLIPMASNQNRL 180 D GIF+GYS NSRA+RVYN R+R +ME+INV+ D+ E A P+ S + Sbjct: 1006 DDGIFLGYSINSRAYRVYNKRSRIVMESINVSIDDYYTRQEEIFAETSPIFRSESEDS-- 1063 Query: 181 GPTPNQQ 201 PT ++Q Sbjct: 1064 -PTTDEQ 1069 >gb|PNY16758.1| gag-pol polyprotein [Trifolium pratense] Length = 704 Score = 55.1 bits (131), Expect = 4e-06 Identities = 32/65 (49%), Positives = 41/65 (63%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPPLIPMASNQNRL 180 D GIFIGYS NSRA+RV+N RTR +ME+INV D+ S + S A+E ++ Sbjct: 74 DEGIFIGYSTNSRAYRVFNSRTRTMMESINVVIDD-SDLTSVDPAVETDVVTPV------ 126 Query: 181 GPTPN 195 PTPN Sbjct: 127 -PTPN 130 >gb|PNY10358.1| retrotransposon-related protein, partial [Trifolium pratense] Length = 1208 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPPLIPM 159 D GIF+GYS NSRA+RV+N RTR IME+INV D+ ++ S+ L+P+ Sbjct: 577 DEGIFLGYSINSRAYRVFNSRTRTIMESINVVIDDSAEEMSDAETNVATLVPI 629 >ref|XP_008229478.1| PREDICTED: uncharacterized protein LOC103328852 [Prunus mume] Length = 1203 Score = 54.7 bits (130), Expect = 6e-06 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLAL-EPPLIPMASNQNR 177 D GIF+GYS +SRA+RVYN R+R I+E+INV D+ + AS +AL E L+P Sbjct: 1021 DKGIFLGYSTSSRAYRVYNCRSRTIIESINVTIDDFA--ASTEMALDEDDLLP------- 1071 Query: 178 LGPTPNQQTSG 210 P P Q++ G Sbjct: 1072 -PPPPEQESPG 1081 >gb|AAC64917.1| gag-pol polyprotein [Glycine max] Length = 1550 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELS 111 D GIF+GYS NSRA+RV+N RTR +ME+INV D+L+ Sbjct: 917 DAGIFLGYSTNSRAYRVFNSRTRTVMESINVVVDDLT 953 >gb|AAO73525.1| gag-pol polyprotein [Glycine max] Length = 1576 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELS 111 D GIF+GYS NSRA+RV+N RTR +ME+INV D+L+ Sbjct: 943 DAGIFLGYSTNSRAYRVFNSRTRTVMESINVVVDDLT 979 >gb|AAO73529.1| gag-pol polyprotein [Glycine max] Length = 1577 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDELS 111 D GIF+GYS NSRA+RV+N RTR +ME+INV D+L+ Sbjct: 944 DAGIFLGYSTNSRAYRVFNSRTRTVMESINVVVDDLT 980 >ref|XP_023891352.1| wall-associated receptor kinase-like 10 [Quercus suber] Length = 576 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +1 Query: 7 GIFIGYSENSRAFRVYNGRTRKIMETINVNFDELSQMASERLALEPP 147 GIF+GYS S+A+RVYN RT K+MET+NV D+ S +SE+ E P Sbjct: 108 GIFLGYSSASKAYRVYNKRTMKVMETVNVVIDKSSNSSSEKGIEELP 154 >gb|PNX66233.1| gag-pol polyprotein [Trifolium pratense] Length = 107 Score = 51.6 bits (122), Expect = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +1 Query: 1 DIGIFIGYSENSRAFRVYNGRTRKIMETINVNFDEL 108 D GIF+GYS NSRA+RVYN RT+ +ME+INV D++ Sbjct: 6 DEGIFLGYSTNSRAYRVYNYRTKTMMESINVVIDDI 41