BLASTX nr result
ID: Chrysanthemum21_contig00034991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034991 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022012843.1| BTB/POZ domain-containing protein At5g66560-... 74 2e-12 ref|XP_023770357.1| BTB/POZ domain-containing protein At5g66560-... 72 2e-11 gb|KVH92556.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 68 4e-10 gb|PNY00416.1| BTB/POZ domain-containing protein, partial [Trifo... 66 2e-09 ref|XP_013446439.1| phototropic-responsive NPH3 family protein [... 66 2e-09 gb|KVI02640.1| BTB/POZ fold, partial [Cynara cardunculus var. sc... 66 2e-09 gb|KHN13354.1| BTB/POZ domain-containing protein [Glycine soja] 66 2e-09 ref|XP_023730130.1| BTB/POZ domain-containing protein At5g66560-... 66 2e-09 ref|XP_004509199.1| PREDICTED: BTB/POZ domain-containing protein... 66 2e-09 ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein... 66 2e-09 ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phas... 66 2e-09 ref|XP_020204130.1| BTB/POZ domain-containing protein At5g66560-... 66 2e-09 dbj|BAT75521.1| hypothetical protein VIGAN_01339400 [Vigna angul... 66 2e-09 ref|XP_017405709.1| PREDICTED: BTB/POZ domain-containing protein... 66 2e-09 ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein... 66 2e-09 dbj|GAU12962.1| hypothetical protein TSUD_191530 [Trifolium subt... 66 2e-09 ref|XP_014510066.1| BTB/POZ domain-containing protein At5g66560 ... 66 2e-09 gb|KRH69996.1| hypothetical protein GLYMA_02G061400 [Glycine max] 66 2e-09 ref|XP_013446437.1| phototropic-responsive NPH3 family protein [... 66 2e-09 dbj|BAJ90603.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 2e-09 >ref|XP_022012843.1| BTB/POZ domain-containing protein At5g66560-like [Helianthus annuus] gb|OTF96029.1| putative phototropic-responsive NPH3 family protein [Helianthus annuus] Length = 641 Score = 74.3 bits (181), Expect = 2e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 116 PESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 PESSKRQAWFCTTGLPSDV VDV +MTFHLHK PL AK Sbjct: 6 PESSKRQAWFCTTGLPSDVVVDVGDMTFHLHKFPLMAK 43 >ref|XP_023770357.1| BTB/POZ domain-containing protein At5g66560-like [Lactuca sativa] gb|PLY80419.1| hypothetical protein LSAT_4X177360 [Lactuca sativa] Length = 655 Score = 71.6 bits (174), Expect = 2e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 116 PESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 PE+SKRQAWFCTTGLPSDV VDV ++TFHLHK PL AK Sbjct: 6 PETSKRQAWFCTTGLPSDVVVDVGDVTFHLHKFPLMAK 43 >gb|KVH92556.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 638 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 113 ESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 E+SKRQAWFCTTGLPSDV VDV +M+FHLHK PL A+ Sbjct: 7 ETSKRQAWFCTTGLPSDVVVDVGDMSFHLHKFPLMAR 43 >gb|PNY00416.1| BTB/POZ domain-containing protein, partial [Trifolium pratense] Length = 457 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSSEKTSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_013446439.1| phototropic-responsive NPH3 family protein [Medicago truncatula] gb|KEH20466.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 464 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >gb|KVI02640.1| BTB/POZ fold, partial [Cynara cardunculus var. scolymus] Length = 605 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 110 SSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +SK QAWFCTTGLPSDV VDV +MTFHLHK PL AK Sbjct: 8 NSKGQAWFCTTGLPSDVVVDVDDMTFHLHKFPLMAK 43 >gb|KHN13354.1| BTB/POZ domain-containing protein [Glycine soja] Length = 616 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_023730130.1| BTB/POZ domain-containing protein At5g66560-like [Lactuca sativa] gb|PLY76714.1| hypothetical protein LSAT_3X93941 [Lactuca sativa] Length = 634 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 110 SSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +SK QAWFCTTGLPSDV VDV+ MTFHLHK PL AK Sbjct: 8 NSKGQAWFCTTGLPSDVVVDVNGMTFHLHKFPLMAK 43 >ref|XP_004509199.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Cicer arietinum] Length = 646 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] gb|KRH08350.1| hypothetical protein GLYMA_16G143800 [Glycine max] gb|KRH08351.1| hypothetical protein GLYMA_16G143800 [Glycine max] gb|KRH08352.1| hypothetical protein GLYMA_16G143800 [Glycine max] Length = 648 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] ref|XP_007155992.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gb|ESW27985.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gb|ESW27986.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] Length = 649 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_020204130.1| BTB/POZ domain-containing protein At5g66560-like [Cajanus cajan] gb|KYP38237.1| BTB/POZ domain-containing protein At1g30440 family [Cajanus cajan] Length = 652 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >dbj|BAT75521.1| hypothetical protein VIGAN_01339400 [Vigna angularis var. angularis] Length = 654 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSTEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_017405709.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Vigna angularis] gb|KOM25594.1| hypothetical protein LR48_Vigan123s001400 [Vigna angularis] Length = 654 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSTEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like isoform X2 [Glycine max] gb|KRH69997.1| hypothetical protein GLYMA_02G061400 [Glycine max] gb|KRH69998.1| hypothetical protein GLYMA_02G061400 [Glycine max] Length = 655 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >dbj|GAU12962.1| hypothetical protein TSUD_191530 [Trifolium subterraneum] Length = 657 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSSEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_014510066.1| BTB/POZ domain-containing protein At5g66560 isoform X1 [Vigna radiata var. radiata] Length = 658 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >gb|KRH69996.1| hypothetical protein GLYMA_02G061400 [Glycine max] Length = 660 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >ref|XP_013446437.1| phototropic-responsive NPH3 family protein [Medicago truncatula] gb|KEH20464.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 661 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 131 LSDMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 +S + SSK QAWFCTTGLPSD+ V+V +MTFHLHK PL +K Sbjct: 1 MSSAEKPSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSK 43 >dbj|BAJ90603.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 668 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 125 DMQPESSKRQAWFCTTGLPSDVTVDVSNMTFHLHKLPLTAK 3 D Q S K QAWFCTTGLPSDV ++V +MTFHLHK PL +K Sbjct: 14 DQQQHSPKGQAWFCTTGLPSDVVIEVGDMTFHLHKFPLMSK 54