BLASTX nr result
ID: Chrysanthemum21_contig00034628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034628 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035602.1| uncharacterized protein At5g41620 [Helianthu... 65 2e-09 >ref|XP_022035602.1| uncharacterized protein At5g41620 [Helianthus annuus] gb|OTG29203.1| hypothetical protein HannXRQ_Chr04g0119651 [Helianthus annuus] Length = 589 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 450 RMDRSGTGSHRRISMSQKPPRLEDHNGEVYDSLSNASLMEV 328 RMDRSGTGSHRRIS +P RLED+NGEV+DSLSN SLME+ Sbjct: 148 RMDRSGTGSHRRISSGHRP-RLEDNNGEVFDSLSNTSLMEI 187