BLASTX nr result
ID: Chrysanthemum21_contig00034600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034600 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021687822.1| DNA primase small subunit [Hevea brasiliensis] 86 4e-17 ref|XP_018815538.1| PREDICTED: DNA primase small subunit [Juglan... 86 5e-17 ref|XP_015572761.1| PREDICTED: DNA primase small subunit [Ricinu... 85 9e-17 gb|EEF46528.1| DNA primase, putative [Ricinus communis] 85 1e-16 emb|CBI34473.3| unnamed protein product, partial [Vitis vinifera] 84 2e-16 ref|XP_021627527.1| DNA primase small subunit [Manihot esculenta... 84 2e-16 ref|XP_002270595.3| PREDICTED: DNA primase small subunit [Vitis ... 84 2e-16 ref|XP_012065032.1| DNA primase small subunit [Jatropha curcas] ... 83 3e-16 gb|PPD76440.1| hypothetical protein GOBAR_DD26618 [Gossypium bar... 82 4e-16 ref|XP_019422497.1| PREDICTED: DNA primase small subunit isoform... 83 5e-16 ref|XP_019422496.1| PREDICTED: DNA primase small subunit isoform... 83 5e-16 gb|KQK96535.1| hypothetical protein SETIT_012155mg [Setaria ital... 83 5e-16 ref|XP_010262967.1| PREDICTED: DNA primase small subunit isoform... 83 5e-16 ref|XP_023770181.1| DNA primase small subunit [Lactuca sativa] >... 83 5e-16 ref|XP_004981874.1| DNA primase small subunit [Setaria italica] ... 83 5e-16 ref|XP_002440953.2| DNA primase small subunit [Sorghum bicolor] ... 83 5e-16 gb|KQJ93317.2| hypothetical protein BRADI_3g03817v3 [Brachypodiu... 83 5e-16 ref|XP_017606557.1| PREDICTED: DNA primase small subunit-like is... 82 5e-16 ref|XP_012439764.1| PREDICTED: DNA primase small subunit isoform... 82 5e-16 ref|XP_010262965.1| PREDICTED: DNA primase small subunit isoform... 83 5e-16 >ref|XP_021687822.1| DNA primase small subunit [Hevea brasiliensis] Length = 450 Score = 85.9 bits (211), Expect = 4e-17 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVEREL+FDIDISDYDN RYCC SG+DVCLD Sbjct: 110 VDPAKRHAYSQSGDNVFTPVERELIFDIDISDYDNVRYCC-SGADVCLD 157 >ref|XP_018815538.1| PREDICTED: DNA primase small subunit [Juglans regia] Length = 458 Score = 85.5 bits (210), Expect = 5e-17 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+FAPVERELVFDIDI+DYD+ RYCC SG+DVCLD Sbjct: 119 VDPAKRHAYAQSGDNVFAPVERELVFDIDITDYDDVRYCC-SGADVCLD 166 >ref|XP_015572761.1| PREDICTED: DNA primase small subunit [Ricinus communis] ref|XP_015572762.1| PREDICTED: DNA primase small subunit [Ricinus communis] Length = 445 Score = 84.7 bits (208), Expect = 9e-17 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVEREL+FDID+SDYDN RYCC SG+DVCLD Sbjct: 106 VDPAKRHAYSQSGDNVFTPVERELIFDIDMSDYDNVRYCC-SGADVCLD 153 >gb|EEF46528.1| DNA primase, putative [Ricinus communis] Length = 515 Score = 84.7 bits (208), Expect = 1e-16 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVEREL+FDID+SDYDN RYCC SG+DVCLD Sbjct: 106 VDPAKRHAYSQSGDNVFTPVERELIFDIDMSDYDNVRYCC-SGADVCLD 153 >emb|CBI34473.3| unnamed protein product, partial [Vitis vinifera] Length = 447 Score = 84.0 bits (206), Expect = 2e-16 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDIDI+DYD+ RYCC SG+DVCLD Sbjct: 107 VDPTKRHAYAQSGDNVFTPVERELVFDIDITDYDDVRYCC-SGADVCLD 154 >ref|XP_021627527.1| DNA primase small subunit [Manihot esculenta] gb|OAY37780.1| hypothetical protein MANES_11G128600 [Manihot esculenta] Length = 450 Score = 84.0 bits (206), Expect = 2e-16 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SG+N+F PVEREL+FDIDISDYDN RYCC SG+DVCLD Sbjct: 110 VDPAKRHAYSQSGNNVFTPVERELIFDIDISDYDNVRYCC-SGADVCLD 157 >ref|XP_002270595.3| PREDICTED: DNA primase small subunit [Vitis vinifera] ref|XP_019079968.1| PREDICTED: DNA primase small subunit [Vitis vinifera] Length = 459 Score = 84.0 bits (206), Expect = 2e-16 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDIDI+DYD+ RYCC SG+DVCLD Sbjct: 119 VDPTKRHAYAQSGDNVFTPVERELVFDIDITDYDDVRYCC-SGADVCLD 166 >ref|XP_012065032.1| DNA primase small subunit [Jatropha curcas] ref|XP_012065033.1| DNA primase small subunit [Jatropha curcas] ref|XP_020532645.1| DNA primase small subunit [Jatropha curcas] Length = 449 Score = 83.2 bits (204), Expect = 3e-16 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVEREL+FDID+SDYDN RYCC G+DVCLD Sbjct: 109 VDPAKRHAYAQSGDNVFTPVERELIFDIDMSDYDNVRYCC-LGADVCLD 156 >gb|PPD76440.1| hypothetical protein GOBAR_DD26618 [Gossypium barbadense] Length = 357 Score = 82.4 bits (202), Expect = 4e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDIDISDYD+ RYCC +G+DVCL+ Sbjct: 112 VDPAKRHAYAQSGDNVFTPVERELVFDIDISDYDDVRYCC-TGADVCLE 159 >ref|XP_019422497.1| PREDICTED: DNA primase small subunit isoform X2 [Lupinus angustifolius] Length = 445 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVEREL+FDIDISDYD+ RYCC SG+DVCL+ Sbjct: 107 VDPSKRHAYAQSGDNVFTPVERELIFDIDISDYDDVRYCC-SGADVCLN 154 >ref|XP_019422496.1| PREDICTED: DNA primase small subunit isoform X1 [Lupinus angustifolius] gb|OIV92644.1| hypothetical protein TanjilG_17995 [Lupinus angustifolius] Length = 447 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVEREL+FDIDISDYD+ RYCC SG+DVCL+ Sbjct: 107 VDPSKRHAYAQSGDNVFTPVERELIFDIDISDYDDVRYCC-SGADVCLN 154 >gb|KQK96535.1| hypothetical protein SETIT_012155mg [Setaria italica] Length = 450 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SG+N+F PVEREL+FDIDISDYD+ RYCC SG+DVCLD Sbjct: 115 VDPAKRHAYAQSGNNVFVPVERELIFDIDISDYDDVRYCC-SGADVCLD 162 >ref|XP_010262967.1| PREDICTED: DNA primase small subunit isoform X2 [Nelumbo nucifera] ref|XP_010262968.1| PREDICTED: DNA primase small subunit isoform X2 [Nelumbo nucifera] ref|XP_010262969.1| PREDICTED: DNA primase small subunit isoform X2 [Nelumbo nucifera] ref|XP_010262970.1| PREDICTED: DNA primase small subunit isoform X2 [Nelumbo nucifera] Length = 452 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDID++DYD+ RYCC SG+DVCLD Sbjct: 112 VDPAKRHAYAQSGDNVFTPVERELVFDIDMTDYDDVRYCC-SGADVCLD 159 >ref|XP_023770181.1| DNA primase small subunit [Lactuca sativa] ref|XP_023770182.1| DNA primase small subunit [Lactuca sativa] gb|PLY80557.1| hypothetical protein LSAT_6X12240 [Lactuca sativa] Length = 453 Score = 82.8 bits (203), Expect = 5e-16 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KR AY SGDNIF PVERELVFDIDISDYD+ARYCC SG+DVCLD Sbjct: 115 VDPSKRLAYAQSGDNIFTPVERELVFDIDISDYDDARYCC-SGADVCLD 162 >ref|XP_004981874.1| DNA primase small subunit [Setaria italica] gb|KQK87255.1| hypothetical protein SETIT_039522mg [Setaria italica] Length = 453 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SG+N+F PVEREL+FDIDISDYD+ RYCC SG+DVCLD Sbjct: 115 VDPAKRHAYAQSGNNVFVPVERELIFDIDISDYDDVRYCC-SGADVCLD 162 >ref|XP_002440953.2| DNA primase small subunit [Sorghum bicolor] gb|KXG21801.1| hypothetical protein SORBI_3009G109300 [Sorghum bicolor] Length = 455 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SG+N+F PVEREL+FDIDISDYD+ RYCC SG+DVCLD Sbjct: 115 VDPSKRHAYAQSGNNVFVPVERELIFDIDISDYDDVRYCC-SGADVCLD 162 >gb|KQJ93317.2| hypothetical protein BRADI_3g03817v3 [Brachypodium distachyon] Length = 458 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SG+N+FAPVEREL+FDIDISDYD+ RYCC SG+D CLD Sbjct: 103 VDPAKRHAYAQSGNNVFAPVERELIFDIDISDYDDVRYCC-SGADTCLD 150 >ref|XP_017606557.1| PREDICTED: DNA primase small subunit-like isoform X2 [Gossypium arboreum] ref|XP_017634689.1| PREDICTED: DNA primase small subunit-like isoform X2 [Gossypium arboreum] Length = 378 Score = 82.4 bits (202), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDIDISDYD+ RYCC +G+DVCL+ Sbjct: 112 VDPAKRHAYAQSGDNVFTPVERELVFDIDISDYDDVRYCC-TGADVCLE 159 >ref|XP_012439764.1| PREDICTED: DNA primase small subunit isoform X2 [Gossypium raimondii] Length = 378 Score = 82.4 bits (202), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDIDISDYD+ RYCC +G+DVCL+ Sbjct: 112 VDPAKRHAYAQSGDNVFTPVERELVFDIDISDYDDVRYCC-TGADVCLE 159 >ref|XP_010262965.1| PREDICTED: DNA primase small subunit isoform X1 [Nelumbo nucifera] ref|XP_010262966.1| PREDICTED: DNA primase small subunit isoform X1 [Nelumbo nucifera] Length = 466 Score = 82.8 bits (203), Expect = 5e-16 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 179 IEP*KRHAYVASGDNIFAPVERELVFDIDISDYDNARYCC*SGSDVCLD 325 ++P KRHAY SGDN+F PVERELVFDID++DYD+ RYCC SG+DVCLD Sbjct: 126 VDPAKRHAYAQSGDNVFTPVERELVFDIDMTDYDDVRYCC-SGADVCLD 173