BLASTX nr result
ID: Chrysanthemum21_contig00034544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034544 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021972646.1| lysM domain-containing GPI-anchored protein ... 89 3e-18 ref|XP_021976452.1| lysM domain-containing GPI-anchored protein ... 84 2e-16 gb|KVI05403.1| Peptidoglycan-binding lysin domain-containing pro... 82 8e-16 ref|XP_023762850.1| lysM domain-containing GPI-anchored protein ... 71 5e-12 ref|XP_019176954.1| PREDICTED: lysM domain-containing GPI-anchor... 60 6e-08 dbj|GAY41769.1| hypothetical protein CUMW_062020, partial [Citru... 57 4e-07 ref|XP_006472764.1| PREDICTED: lysM domain-containing GPI-anchor... 57 4e-07 ref|XP_006434175.1| lysM domain-containing GPI-anchored protein ... 57 4e-07 emb|CBI19031.3| unnamed protein product, partial [Vitis vinifera] 56 1e-06 ref|XP_002285848.1| PREDICTED: lysM domain-containing GPI-anchor... 56 1e-06 ref|XP_009627327.1| PREDICTED: lysM domain-containing GPI-anchor... 55 2e-06 >ref|XP_021972646.1| lysM domain-containing GPI-anchored protein 1-like [Helianthus annuus] gb|OTG20159.1| putative lysM domain-containing protein [Helianthus annuus] Length = 429 Score = 89.0 bits (219), Expect = 3e-18 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = -1 Query: 356 GSVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMIPFL 195 GSVVPST SS+ FPPSANGPSG+ S ACTL NPLS+FSLAM LVLF+KVM PFL Sbjct: 376 GSVVPSTSSSLVFPPSANGPSGTSSRACTLVNPLSSFSLAMVLVLFLKVMFPFL 429 >ref|XP_021976452.1| lysM domain-containing GPI-anchored protein 1-like [Helianthus annuus] gb|OTG17508.1| putative lysm domain GPI-anchored protein 1 precursor [Helianthus annuus] Length = 420 Score = 84.0 bits (206), Expect = 2e-16 Identities = 41/55 (74%), Positives = 49/55 (89%), Gaps = 1/55 (1%) Frame = -1 Query: 356 GSVVPS-TGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMIPFL 195 GSVVPS TGSSIAFPPSANGPSGS+S ACTL NP+S FSLA+ LV+F+ +++PFL Sbjct: 366 GSVVPSSTGSSIAFPPSANGPSGSISAACTLVNPISGFSLAVVLVVFLGLVVPFL 420 >gb|KVI05403.1| Peptidoglycan-binding lysin domain-containing protein [Cynara cardunculus var. scolymus] Length = 419 Score = 82.0 bits (201), Expect = 8e-16 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = -1 Query: 356 GSVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMIPFL 195 GSVVPST SSI PPSANGPSGS SG C+L NPL + S+A+ LVLF+KVM+PFL Sbjct: 366 GSVVPSTSSSIVLPPSANGPSGSFSGGCSLVNPLFSSSIAIGLVLFLKVMLPFL 419 >ref|XP_023762850.1| lysM domain-containing GPI-anchored protein 1-like [Lactuca sativa] gb|PLY86273.1| hypothetical protein LSAT_8X41620 [Lactuca sativa] Length = 423 Score = 71.2 bits (173), Expect = 5e-12 Identities = 36/56 (64%), Positives = 47/56 (83%), Gaps = 3/56 (5%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSG-SVSGACTLANPLSTFSLAMALVLFVKV--MIPFL 195 SVVPS+GSSI PP+ANGPSG S++GACTL NPL+T +++ LVLF+KV ++PFL Sbjct: 368 SVVPSSGSSIVLPPAANGPSGSSINGACTLVNPLTTSFISIGLVLFLKVVKVVPFL 423 >ref|XP_019176954.1| PREDICTED: lysM domain-containing GPI-anchored protein 1-like [Ipomoea nil] ref|XP_019176955.1| PREDICTED: lysM domain-containing GPI-anchored protein 1-like [Ipomoea nil] Length = 475 Score = 59.7 bits (143), Expect = 6e-08 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 353 SVVPST-GSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVPST GS+IAFPPS NGPSGS S ACTL +PLS F A+ L LF+K I Sbjct: 424 SVVPSTAGSAIAFPPS-NGPSGSSSSACTLLSPLSRFPNAVMLGLFLKYWI 473 >dbj|GAY41769.1| hypothetical protein CUMW_062020, partial [Citrus unshiu] Length = 327 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVPS+GS PP A+GPSGSVS AC+L N LSTF A L LFVK ++ Sbjct: 276 SVVPSSGSIPGLPP-ASGPSGSVSSACSLTNSLSTFPPAFMLYLFVKFIV 324 >ref|XP_006472764.1| PREDICTED: lysM domain-containing GPI-anchored protein 1 [Citrus sinensis] gb|KDO80683.1| hypothetical protein CISIN_1g014940mg [Citrus sinensis] Length = 415 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVPS+GS PP A+GPSGSVS AC+L N LSTF A L LFVK ++ Sbjct: 364 SVVPSSGSIPGLPP-ASGPSGSVSSACSLTNSLSTFPPAFMLYLFVKFIV 412 >ref|XP_006434175.1| lysM domain-containing GPI-anchored protein 1 [Citrus clementina] gb|ESR47415.1| hypothetical protein CICLE_v10001310mg [Citrus clementina] Length = 415 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVPS+GS PP A+GPSGSVS AC+L N LSTF A L LFVK ++ Sbjct: 364 SVVPSSGSIPGLPP-ASGPSGSVSSACSLTNSLSTFPPAFMLYLFVKFIV 412 >emb|CBI19031.3| unnamed protein product, partial [Vitis vinifera] Length = 408 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVPSTGS F P ANGP+GS S A +L NPL++F + +AL LF K+M+ Sbjct: 356 SVVPSTGSIPGFAP-ANGPTGSASDASSLVNPLASFPVVIALCLFFKLMV 404 >ref|XP_002285848.1| PREDICTED: lysM domain-containing GPI-anchored protein 1 [Vitis vinifera] Length = 418 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVPSTGS F P ANGP+GS S A +L NPL++F + +AL LF K+M+ Sbjct: 366 SVVPSTGSIPGFAP-ANGPTGSASDASSLVNPLASFPVVIALCLFFKLMV 414 >ref|XP_009627327.1| PREDICTED: lysM domain-containing GPI-anchored protein 1-like [Nicotiana tomentosiformis] ref|XP_016445700.1| PREDICTED: lysM domain-containing GPI-anchored protein 1-like [Nicotiana tabacum] Length = 417 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -1 Query: 353 SVVPSTGSSIAFPPSANGPSGSVSGACTLANPLSTFSLAMALVLFVKVMI 204 SVVP++GS IAFPPS GPSGS S AC L NPL++F +A+ L L VK +I Sbjct: 366 SVVPASGSVIAFPPS-GGPSGSASSAC-LLNPLASFPIAILLYLCVKYVI 413