BLASTX nr result
ID: Chrysanthemum21_contig00034540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034540 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022032661.1| protein ATAF2-like [Helianthus annuus] >gi|1... 69 4e-11 gb|OTG15756.1| putative NAC domain-containing protein [Helianthu... 69 4e-11 ref|XP_022037211.1| NAC domain-containing protein 67-like [Helia... 68 8e-11 ref|XP_022031306.1| putative NAC domain-containing protein 94 [H... 67 4e-10 ref|XP_021982819.1| NAC domain-containing protein 67-like [Helia... 66 4e-10 ref|XP_022004505.1| protein CUP-SHAPED COTYLEDON 1-like [Heliant... 63 1e-09 gb|OTG03127.1| putative NAC domain-containing protein [Helianthu... 63 1e-09 gb|OTG03125.1| putative NAC domain-containing protein [Helianthu... 63 1e-09 gb|OTG03126.1| putative NAC domain-containing protein [Helianthu... 63 1e-09 ref|XP_022032916.1| NAC domain-containing protein 76-like [Helia... 64 2e-09 gb|OTG03128.1| putative NAC domain-containing protein [Helianthu... 63 4e-09 ref|XP_022004502.1| putative NAC domain-containing protein 94 [H... 63 5e-09 ref|XP_022004506.1| transcription factor JUNGBRUNNEN 1-like [Hel... 63 5e-09 ref|XP_022004500.1| putative NAC domain-containing protein 94 [H... 63 6e-09 ref|XP_022004503.1| putative NAC domain-containing protein 94 [H... 63 6e-09 ref|XP_022033068.1| NAC domain-containing protein 72-like [Helia... 58 4e-07 >ref|XP_022032661.1| protein ATAF2-like [Helianthus annuus] gb|OTG28665.1| putative NAC domain-containing protein [Helianthus annuus] Length = 332 Score = 68.9 bits (167), Expect = 4e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRPPKC 349 Y +QEQ DY D+L PG+RFCPTD ELI+YYLKPKI+TG PKC Sbjct: 7 YAHQEQPDYVDNLLPGYRFCPTDSELILYYLKPKIETGEH-PKC 49 >gb|OTG15756.1| putative NAC domain-containing protein [Helianthus annuus] Length = 337 Score = 68.9 bits (167), Expect = 4e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRPPKC 349 Y +QEQ DY D+L PG+RFCPTD ELI+YYLKPKI+TG PKC Sbjct: 7 YAHQEQPDYVDNLLPGYRFCPTDSELILYYLKPKIETGEH-PKC 49 >ref|XP_022037211.1| NAC domain-containing protein 67-like [Helianthus annuus] gb|OTG37910.1| putative NAC domain-containing protein [Helianthus annuus] Length = 322 Score = 68.2 bits (165), Expect = 8e-11 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +2 Query: 227 QEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRPPKCPDIMKSIY 373 QEQ DY D+L PG+RFCPTD ELI+YYLKPKI+TG+ PKC ++Y Sbjct: 10 QEQPDYLDNLPPGYRFCPTDSELILYYLKPKIETGKH-PKCRIYAVNLY 57 >ref|XP_022031306.1| putative NAC domain-containing protein 94 [Helianthus annuus] gb|OTG38049.1| putative NAC domain-containing protein [Helianthus annuus] Length = 422 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRPPKC 349 Y +QEQ DY D+L P +RFCPTD ELI+YYLKPKI+TG PKC Sbjct: 7 YAHQEQPDYVDNLLPSYRFCPTDSELILYYLKPKIETGEH-PKC 49 >ref|XP_021982819.1| NAC domain-containing protein 67-like [Helianthus annuus] gb|OTG37909.1| putative NAC domain-containing protein [Helianthus annuus] Length = 324 Score = 66.2 bits (160), Expect = 4e-10 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 227 QEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 QEQ DY D+L PG+RFCPTD ELI+YYLKPKI+TG P Sbjct: 10 QEQPDYLDNLPPGYRFCPTDSELILYYLKPKIETGEHP 47 >ref|XP_022004505.1| protein CUP-SHAPED COTYLEDON 1-like [Helianthus annuus] Length = 172 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >gb|OTG03127.1| putative NAC domain-containing protein [Helianthus annuus] Length = 172 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >gb|OTG03125.1| putative NAC domain-containing protein [Helianthus annuus] Length = 172 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >gb|OTG03126.1| putative NAC domain-containing protein [Helianthus annuus] Length = 189 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >ref|XP_022032916.1| NAC domain-containing protein 76-like [Helianthus annuus] gb|OTG29239.1| putative NAC domain-containing protein [Helianthus annuus] Length = 441 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 221 NNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRPPKC 349 + QE+ DYA SLEPG+RFCPTD ELIV+YLK KI+TG PKC Sbjct: 12 SRQEELDYAGSLEPGYRFCPTDSELIVHYLKRKIETGEH-PKC 53 >gb|OTG03128.1| putative NAC domain-containing protein [Helianthus annuus] Length = 291 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >ref|XP_022004502.1| putative NAC domain-containing protein 94 [Helianthus annuus] Length = 319 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >ref|XP_022004506.1| transcription factor JUNGBRUNNEN 1-like [Helianthus annuus] Length = 341 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >ref|XP_022004500.1| putative NAC domain-containing protein 94 [Helianthus annuus] Length = 367 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >ref|XP_022004503.1| putative NAC domain-containing protein 94 [Helianthus annuus] Length = 367 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RFCPTD ELI+YYLK KI+ G +P Sbjct: 10 YIQQELRDYDDALEPGYRFCPTDSELIIYYLKRKIELGEQP 50 >ref|XP_022033068.1| NAC domain-containing protein 72-like [Helianthus annuus] gb|OTG29704.1| putative NAC domain-containing protein [Helianthus annuus] Length = 343 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +2 Query: 218 YNNQEQHDYADSLEPGFRFCPTDVELIVYYLKPKIDTGRRP 340 Y QE DY D+LEPG+RF PTD EL+VYYLK KI+ G +P Sbjct: 10 YIQQELCDYDDALEPGYRFRPTDAELLVYYLKRKIELGEQP 50