BLASTX nr result
ID: Chrysanthemum21_contig00034512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034512 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI05610.1| hypothetical protein Ccrd_016064 [Cynara carduncu... 54 9e-06 >gb|KVI05610.1| hypothetical protein Ccrd_016064 [Cynara cardunculus var. scolymus] Length = 588 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -2 Query: 224 DEEVQAEIFVMEGSGKHHGDEPSSERSQCAEDVTSVKDESMQVGN 90 +EEVQ++ MEGSGK ++P S +S CAE+ TSVKDES + G+ Sbjct: 127 EEEVQSDTLAMEGSGKGQEEKPDSNQSHCAEEATSVKDESFRNGS 171