BLASTX nr result
ID: Chrysanthemum21_contig00034456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034456 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023740330.1| uncharacterized protein LOC111888376 [Lactuc... 73 1e-13 gb|KVH96060.1| hypothetical protein Ccrd_001857 [Cynara carduncu... 71 5e-13 ref|XP_022020157.1| uncharacterized protein LOC110920242 [Helian... 69 2e-12 ref|XP_022014238.1| uncharacterized protein LOC110913721 [Helian... 69 3e-12 emb|CAN78386.1| hypothetical protein VITISV_017367 [Vitis vinifera] 64 3e-10 ref|XP_002283053.1| PREDICTED: uncharacterized protein LOC100243... 64 3e-10 ref|XP_018829028.1| PREDICTED: uncharacterized protein LOC108997... 63 1e-09 ref|XP_016729695.1| PREDICTED: uncharacterized protein LOC107940... 62 2e-09 ref|XP_012479914.1| PREDICTED: uncharacterized protein LOC105795... 62 2e-09 ref|XP_016691792.1| PREDICTED: uncharacterized protein LOC107908... 62 3e-09 emb|CBI37729.3| unnamed protein product, partial [Vitis vinifera] 64 3e-09 ref|XP_022725816.1| uncharacterized protein LOC111282124 [Durio ... 61 5e-09 gb|OMP03395.1| hypothetical protein CCACVL1_02440 [Corchorus cap... 61 7e-09 gb|OMO59107.1| hypothetical protein COLO4_34318 [Corchorus olito... 61 7e-09 ref|XP_021287117.1| uncharacterized protein LOC110418657 [Herran... 61 7e-09 ref|XP_007043088.2| PREDICTED: uncharacterized protein LOC186083... 61 7e-09 gb|EOX98919.1| Uncharacterized protein TCM_007583 [Theobroma cacao] 61 7e-09 ref|XP_023903454.1| uncharacterized protein LOC112015298 [Quercu... 60 1e-08 ref|XP_021912754.1| uncharacterized protein LOC110826422 [Carica... 60 1e-08 gb|PON89892.1| hypothetical protein TorRG33x02_141780 [Trema ori... 60 2e-08 >ref|XP_023740330.1| uncharacterized protein LOC111888376 [Lactuca sativa] gb|PLY68853.1| hypothetical protein LSAT_3X48420 [Lactuca sativa] Length = 149 Score = 73.2 bits (178), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYSSTV 125 HNKGS RH+LYKFRSEIRKL+GSDQ GLPQTIR SYSS + Sbjct: 109 HNKGSLRHILYKFRSEIRKLVGSDQAGLPQTIRSKSYSSAI 149 >gb|KVH96060.1| hypothetical protein Ccrd_001857 [Cynara cardunculus var. scolymus] Length = 141 Score = 71.2 bits (173), Expect = 5e-13 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYSSTV 125 HNKGSWRH+LYK RSEIRKL+ SDQ GLPQTIR +YSS + Sbjct: 101 HNKGSWRHILYKVRSEIRKLVRSDQAGLPQTIRTKAYSSAI 141 >ref|XP_022020157.1| uncharacterized protein LOC110920242 [Helianthus annuus] gb|OTF93017.1| hypothetical protein HannXRQ_Chr16g0528291 [Helianthus annuus] Length = 129 Score = 69.3 bits (168), Expect = 2e-12 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV+YKFRSEIRKL+GSDQ GLPQTIR S Sbjct: 91 HNKGSWRHVIYKFRSEIRKLVGSDQPGLPQTIRYKS 126 >ref|XP_022014238.1| uncharacterized protein LOC110913721 [Helianthus annuus] gb|OTF95138.1| hypothetical protein HannXRQ_Chr15g0479801 [Helianthus annuus] Length = 129 Score = 68.9 bits (167), Expect = 3e-12 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV+YKFRSEIRKL+GSDQ GLPQT+R S Sbjct: 91 HNKGSWRHVIYKFRSEIRKLVGSDQPGLPQTVRYKS 126 >emb|CAN78386.1| hypothetical protein VITISV_017367 [Vitis vinifera] Length = 151 Score = 64.3 bits (155), Expect = 3e-10 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYS 116 HNKGSWRHV YK RSE+R+L+GSD+ GLPQT R SYS Sbjct: 100 HNKGSWRHVFYKVRSELRRLVGSDRVGLPQTCRYDSYS 137 >ref|XP_002283053.1| PREDICTED: uncharacterized protein LOC100243457 [Vitis vinifera] Length = 151 Score = 64.3 bits (155), Expect = 3e-10 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYS 116 HNKGSWRHV YK RSE+R+L+GSD+ GLPQT R SYS Sbjct: 100 HNKGSWRHVFYKVRSELRRLVGSDRVGLPQTCRYDSYS 137 >ref|XP_018829028.1| PREDICTED: uncharacterized protein LOC108997284 [Juglans regia] Length = 161 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYS 116 H+KGSWRHV YK RSEIRKL+GSD GLPQT R SY+ Sbjct: 110 HDKGSWRHVFYKVRSEIRKLVGSDHVGLPQTYRYDSYN 147 >ref|XP_016729695.1| PREDICTED: uncharacterized protein LOC107940758 [Gossypium hirsutum] ref|XP_017632147.1| PREDICTED: uncharacterized protein LOC108474665 [Gossypium arboreum] gb|PPS08089.1| hypothetical protein GOBAR_AA12548 [Gossypium barbadense] Length = 160 Score = 62.4 bits (150), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSEIRKL+GSD+ GLPQT R +S Sbjct: 109 HNKGSWRHVFYKVRSEIRKLVGSDKVGLPQTYRYNS 144 >ref|XP_012479914.1| PREDICTED: uncharacterized protein LOC105795029 [Gossypium raimondii] gb|KJB31970.1| hypothetical protein B456_005G216400 [Gossypium raimondii] Length = 160 Score = 62.4 bits (150), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSEIRKL+GSD+ GLPQT R +S Sbjct: 109 HNKGSWRHVFYKVRSEIRKLVGSDKVGLPQTYRYNS 144 >ref|XP_016691792.1| PREDICTED: uncharacterized protein LOC107908980 [Gossypium hirsutum] gb|PPD77626.1| hypothetical protein GOBAR_DD25448 [Gossypium barbadense] Length = 160 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSEIRKL+GSD+ GLPQT R +S Sbjct: 109 HNKGSWRHVFYKVRSEIRKLVGSDKVGLPQTSRYNS 144 >emb|CBI37729.3| unnamed protein product, partial [Vitis vinifera] Length = 546 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYS 116 HNKGSWRHV YK RSE+R+L+GSD+ GLPQT R SYS Sbjct: 110 HNKGSWRHVFYKVRSELRRLVGSDRVGLPQTCRYDSYS 147 >ref|XP_022725816.1| uncharacterized protein LOC111282124 [Durio zibethinus] Length = 153 Score = 61.2 bits (147), Expect = 5e-09 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSEI+KL+GSD+ GLPQT R S Sbjct: 103 HNKGSWRHVFYKVRSEIKKLVGSDKVGLPQTFRYDS 138 >gb|OMP03395.1| hypothetical protein CCACVL1_02440 [Corchorus capsularis] Length = 152 Score = 60.8 bits (146), Expect = 7e-09 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSEI+KL+GSD+ GLPQT R S Sbjct: 102 HNKGSWRHVFYKVRSEIKKLVGSDKVGLPQTYRYDS 137 >gb|OMO59107.1| hypothetical protein COLO4_34318 [Corchorus olitorius] Length = 152 Score = 60.8 bits (146), Expect = 7e-09 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSEI+KL+GSD+ GLPQT R S Sbjct: 102 HNKGSWRHVFYKVRSEIKKLVGSDKVGLPQTYRYDS 137 >ref|XP_021287117.1| uncharacterized protein LOC110418657 [Herrania umbratica] Length = 153 Score = 60.8 bits (146), Expect = 7e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSE++KL+GSD+ GLPQT R +S Sbjct: 103 HNKGSWRHVFYKVRSEVKKLVGSDKVGLPQTYRYNS 138 >ref|XP_007043088.2| PREDICTED: uncharacterized protein LOC18608374 [Theobroma cacao] Length = 153 Score = 60.8 bits (146), Expect = 7e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSE++KL+GSD+ GLPQT R +S Sbjct: 103 HNKGSWRHVFYKVRSEVKKLVGSDKVGLPQTYRYNS 138 >gb|EOX98919.1| Uncharacterized protein TCM_007583 [Theobroma cacao] Length = 153 Score = 60.8 bits (146), Expect = 7e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSS 110 HNKGSWRHV YK RSE++KL+GSD+ GLPQT R +S Sbjct: 103 HNKGSWRHVFYKVRSEVKKLVGSDKVGLPQTYRYNS 138 >ref|XP_023903454.1| uncharacterized protein LOC112015298 [Quercus suber] ref|XP_023921679.1| uncharacterized protein LOC112033133 [Quercus suber] gb|POE98910.1| hypothetical protein CFP56_65664 [Quercus suber] Length = 162 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 6 NKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSY 113 NKGSWRHV YK RSEIRKL+GSDQ LPQT + SSY Sbjct: 115 NKGSWRHVFYKVRSEIRKLVGSDQVRLPQTYKYSSY 150 >ref|XP_021912754.1| uncharacterized protein LOC110826422 [Carica papaya] Length = 154 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYS 116 HNKGSWRHV YK RSEIR+L+ SDQ GLPQT R S++ Sbjct: 110 HNKGSWRHVFYKVRSEIRRLMRSDQVGLPQTYRYDSFN 147 >gb|PON89892.1| hypothetical protein TorRG33x02_141780 [Trema orientalis] Length = 160 Score = 59.7 bits (143), Expect = 2e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 HNKGSWRHVLYKFRSEIRKLIGSDQGGLPQTIRPSSYS 116 H++GSWRHV YK RSE RKL+GSD+ GLPQT R S+S Sbjct: 110 HSRGSWRHVFYKVRSEFRKLLGSDRVGLPQTCRYDSFS 147