BLASTX nr result
ID: Chrysanthemum21_contig00034328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034328 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG36938.1| putative ATP synthase subunit alpha [Helianthus a... 67 1e-10 >gb|OTG36938.1| putative ATP synthase subunit alpha [Helianthus annuus] Length = 452 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 97 VCLMIKLEMAQLRLLEVENQMVVAAKSHLRIAGPPPPANNR 219 VC KLE+AQLRLLEV+N++VV AKSHLRIAGPPPP NNR Sbjct: 405 VCGSSKLELAQLRLLEVDNRVVVPAKSHLRIAGPPPPTNNR 445