BLASTX nr result
ID: Chrysanthemum21_contig00034078
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00034078 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020420854.1| uncharacterized protein LOC109949504 [Prunus... 56 2e-06 >ref|XP_020420854.1| uncharacterized protein LOC109949504 [Prunus persica] Length = 345 Score = 56.2 bits (134), Expect = 2e-06 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 6/94 (6%) Frame = -2 Query: 320 MRLTSTDSDLLPNPFHDSTLVGKFHYLALTIPTXXXXXXXXXXSVFQAPKSPRLQALVKL 141 ++LT TD DLL +P H LVG+ YL +T P + Q P+ P L+A++++ Sbjct: 107 LKLTPTDGDLLHDPAHYRRLVGRLIYLTITRPDIVYSVHTLSQFMHQ-PRKPHLEAVLRV 165 Query: 140 LIC------QGIFFHTPIFLDLIAFCDSD*ASFP 57 L QG+ F + L L AFCDSD AS P Sbjct: 166 LRYLKGSPGQGLLFPSENNLKLTAFCDSDWASCP 199