BLASTX nr result
ID: Chrysanthemum21_contig00033807
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033807 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023729136.1| uncharacterized protein LOC111876789 [Lactuc... 105 1e-23 gb|KVH97283.1| Protein of unknown function DUF3133 [Cynara cardu... 103 6e-23 ref|XP_022025483.1| uncharacterized protein LOC110926020 isoform... 102 8e-23 ref|XP_022017954.1| uncharacterized protein LOC110917817 isoform... 102 1e-22 ref|XP_022017952.1| uncharacterized protein LOC110917817 isoform... 102 1e-22 ref|XP_022025484.1| uncharacterized protein LOC110926020 isoform... 97 6e-21 ref|XP_022017953.1| uncharacterized protein LOC110917817 isoform... 96 2e-20 gb|PIN26540.1| hypothetical protein CDL12_00710 [Handroanthus im... 86 5e-17 ref|XP_019228861.1| PREDICTED: uncharacterized protein LOC109209... 86 1e-16 ref|XP_016474166.1| PREDICTED: uncharacterized protein LOC107795... 84 3e-16 ref|XP_009762269.1| PREDICTED: uncharacterized protein LOC104214... 84 3e-16 ref|XP_016481246.1| PREDICTED: uncharacterized protein At5g05190... 84 3e-16 ref|XP_009593354.1| PREDICTED: protein ENHANCED DISEASE RESISTAN... 84 3e-16 gb|KRG99688.1| hypothetical protein GLYMA_18G163900 [Glycine max] 77 3e-16 gb|KDO86413.1| hypothetical protein CISIN_1g047011mg [Citrus sin... 84 5e-16 ref|XP_006491240.1| PREDICTED: uncharacterized protein At5g05190... 84 5e-16 ref|XP_006444880.1| protein ENHANCED DISEASE RESISTANCE 4 [Citru... 84 5e-16 dbj|GAY51367.1| hypothetical protein CUMW_133690 [Citrus unshiu] 84 5e-16 ref|XP_021760346.1| protein ENHANCED DISEASE RESISTANCE 4-like [... 83 6e-16 ref|XP_014626127.1| PREDICTED: uncharacterized protein At5g05190... 77 7e-16 >ref|XP_023729136.1| uncharacterized protein LOC111876789 [Lactuca sativa] gb|PLY77504.1| hypothetical protein LSAT_4X34201 [Lactuca sativa] Length = 745 Score = 105 bits (261), Expect = 1e-23 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVT+YAVYQCGGCGAVLRA NKHIES VSSEK Sbjct: 1 MSESPAKVRLVRCPKCENLLPEVTEYAVYQCGGCGAVLRANNKHIESSVSSEK 53 >gb|KVH97283.1| Protein of unknown function DUF3133 [Cynara cardunculus var. scolymus] Length = 751 Score = 103 bits (256), Expect = 6e-23 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVTDYAVYQCGGCGAVLRA NKHI S +SSEK Sbjct: 1 MSESPAKVRLVRCPKCDNLLPEVTDYAVYQCGGCGAVLRATNKHIGSSISSEK 53 >ref|XP_022025483.1| uncharacterized protein LOC110926020 isoform X1 [Helianthus annuus] gb|OTF87463.1| Protein of unknown function (DUF3133) [Helianthus annuus] Length = 707 Score = 102 bits (255), Expect = 8e-23 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVTDYAVYQCGGCGAVLRA NK ++SGVSSEK Sbjct: 1 MSESPAKVRLVRCPKCENLLPEVTDYAVYQCGGCGAVLRAGNKRMDSGVSSEK 53 >ref|XP_022017954.1| uncharacterized protein LOC110917817 isoform X3 [Helianthus annuus] Length = 673 Score = 102 bits (254), Expect = 1e-22 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVT+YAVYQCGGCGAVLRA+NK I+SG+SSEK Sbjct: 1 MSESPAKVRLVRCPKCENLLPEVTEYAVYQCGGCGAVLRAENKRIDSGMSSEK 53 >ref|XP_022017952.1| uncharacterized protein LOC110917817 isoform X1 [Helianthus annuus] gb|OTF92632.1| Protein of unknown function (DUF3133) [Helianthus annuus] Length = 739 Score = 102 bits (254), Expect = 1e-22 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVT+YAVYQCGGCGAVLRA+NK I+SG+SSEK Sbjct: 1 MSESPAKVRLVRCPKCENLLPEVTEYAVYQCGGCGAVLRAENKRIDSGMSSEK 53 >ref|XP_022025484.1| uncharacterized protein LOC110926020 isoform X2 [Helianthus annuus] Length = 706 Score = 97.4 bits (241), Expect = 6e-21 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVTDYAVYQCGGCGAVLR NK ++SGVSSEK Sbjct: 1 MSESPAKVRLVRCPKCENLLPEVTDYAVYQCGGCGAVLRG-NKRMDSGVSSEK 52 >ref|XP_022017953.1| uncharacterized protein LOC110917817 isoform X2 [Helianthus annuus] Length = 738 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSESPAKVRLVRCPKC NLLPEVT+YAVYQCGGCGAVLR +NK I+SG+SSEK Sbjct: 1 MSESPAKVRLVRCPKCENLLPEVTEYAVYQCGGCGAVLR-ENKRIDSGMSSEK 52 >gb|PIN26540.1| hypothetical protein CDL12_00710 [Handroanthus impetiginosus] Length = 895 Score = 86.3 bits (212), Expect = 5e-17 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSE+ AKVRLVRCPKC NLLPEVTD++VYQCGGCGAVLRAKNK +E SEK Sbjct: 1 MSET-AKVRLVRCPKCGNLLPEVTDFSVYQCGGCGAVLRAKNKGLELDTFSEK 52 >ref|XP_019228861.1| PREDICTED: uncharacterized protein LOC109209876 isoform X2 [Nicotiana attenuata] Length = 980 Score = 85.5 bits (210), Expect = 1e-16 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MSE PAKVRLVRCPKC NLLPE+TDY+VYQCGGCGAVLRAKNK+ E +EK Sbjct: 1 MSE-PAKVRLVRCPKCENLLPELTDYSVYQCGGCGAVLRAKNKNGELEEFAEK 52 >ref|XP_016474166.1| PREDICTED: uncharacterized protein LOC107795969 isoform X2 [Nicotiana tabacum] Length = 996 Score = 84.3 bits (207), Expect = 3e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIE 24 MSE PAKVRLVRCPKC NLLPE+TDY+VYQCGGCGAVLRAKNK+ E Sbjct: 1 MSE-PAKVRLVRCPKCENLLPELTDYSVYQCGGCGAVLRAKNKNGE 45 >ref|XP_009762269.1| PREDICTED: uncharacterized protein LOC104214315 isoform X2 [Nicotiana sylvestris] Length = 996 Score = 84.3 bits (207), Expect = 3e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIE 24 MSE PAKVRLVRCPKC NLLPE+TDY+VYQCGGCGAVLRAKNK+ E Sbjct: 1 MSE-PAKVRLVRCPKCENLLPELTDYSVYQCGGCGAVLRAKNKNGE 45 >ref|XP_016481246.1| PREDICTED: uncharacterized protein At5g05190-like isoform X2 [Nicotiana tabacum] Length = 997 Score = 84.3 bits (207), Expect = 3e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIE 24 MSE PAKVRLVRCPKC NLLPE+TDY+VYQCGGCGAVLRAKNK+ E Sbjct: 1 MSE-PAKVRLVRCPKCENLLPELTDYSVYQCGGCGAVLRAKNKNGE 45 >ref|XP_009593354.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 4-like isoform X2 [Nicotiana tomentosiformis] Length = 997 Score = 84.3 bits (207), Expect = 3e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIE 24 MSE PAKVRLVRCPKC NLLPE+TDY+VYQCGGCGAVLRAKNK+ E Sbjct: 1 MSE-PAKVRLVRCPKCENLLPELTDYSVYQCGGCGAVLRAKNKNGE 45 >gb|KRG99688.1| hypothetical protein GLYMA_18G163900 [Glycine max] Length = 68 Score = 77.4 bits (189), Expect = 3e-16 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MS+S K+RLVRCPKC NLL E+ DY+VYQCGGCGAVLRAK+K SG S++ Sbjct: 1 MSDSANKLRLVRCPKCQNLLLELADYSVYQCGGCGAVLRAKHKGYVSGSLSDE 53 >gb|KDO86413.1| hypothetical protein CISIN_1g047011mg [Citrus sinensis] Length = 915 Score = 83.6 bits (205), Expect = 5e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 M+ES K+RLVRCPKC NLLPE+ DY+VYQCGGCGAVLRAKNK E+ SSEK Sbjct: 1 MAES-TKLRLVRCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEK 52 >ref|XP_006491240.1| PREDICTED: uncharacterized protein At5g05190-like [Citrus sinensis] ref|XP_015389706.1| PREDICTED: uncharacterized protein At5g05190-like [Citrus sinensis] Length = 915 Score = 83.6 bits (205), Expect = 5e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 M+ES K+RLVRCPKC NLLPE+ DY+VYQCGGCGAVLRAKNK E+ SSEK Sbjct: 1 MAES-TKLRLVRCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEK 52 >ref|XP_006444880.1| protein ENHANCED DISEASE RESISTANCE 4 [Citrus clementina] ref|XP_024043946.1| protein ENHANCED DISEASE RESISTANCE 4 [Citrus clementina] gb|ESR58120.1| hypothetical protein CICLE_v10018757mg [Citrus clementina] Length = 915 Score = 83.6 bits (205), Expect = 5e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 M+ES K+RLVRCPKC NLLPE+ DY+VYQCGGCGAVLRAKNK E+ SSEK Sbjct: 1 MAES-TKLRLVRCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEK 52 >dbj|GAY51367.1| hypothetical protein CUMW_133690 [Citrus unshiu] Length = 984 Score = 83.6 bits (205), Expect = 5e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 M+ES K+RLVRCPKC NLLPE+ DY+VYQCGGCGAVLRAKNK E+ SSEK Sbjct: 1 MAES-TKLRLVRCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEK 52 >ref|XP_021760346.1| protein ENHANCED DISEASE RESISTANCE 4-like [Chenopodium quinoa] Length = 871 Score = 83.2 bits (204), Expect = 6e-16 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 M+ P+K+RLVRCPKC NLLPE+ DY+VYQCGGCGAVLRAK ++E+G S++ Sbjct: 1 MAVEPSKLRLVRCPKCENLLPELPDYSVYQCGGCGAVLRAKKSNLEAGNGSQR 53 >ref|XP_014626127.1| PREDICTED: uncharacterized protein At5g05190-like [Glycine max] Length = 104 Score = 77.4 bits (189), Expect = 7e-16 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -1 Query: 161 MSESPAKVRLVRCPKCSNLLPEVTDYAVYQCGGCGAVLRAKNKHIESGVSSEK 3 MS+S K+RLVRCPKC NLL E+ DY+VYQCGGCGAVLRAK+K SG S++ Sbjct: 1 MSDSANKLRLVRCPKCQNLLLELVDYSVYQCGGCGAVLRAKHKGYVSGSLSDE 53