BLASTX nr result
ID: Chrysanthemum21_contig00033790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033790 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023734289.1| pentatricopeptide repeat-containing protein ... 68 5e-10 ref|XP_021896778.1| pentatricopeptide repeat-containing protein ... 67 9e-10 gb|PNY14751.1| hypothetical protein L195_g011436 [Trifolium prat... 64 2e-09 dbj|GAU35854.1| hypothetical protein TSUD_63440 [Trifolium subte... 64 2e-09 gb|KVI07769.1| Pentatricopeptide repeat-containing protein [Cyna... 65 3e-09 ref|XP_022036423.1| pentatricopeptide repeat-containing protein ... 65 6e-09 ref|XP_002306075.1| pentatricopeptide repeat-containing family p... 65 6e-09 gb|OTG30015.1| putative tetratricopeptide repeat (TPR)-like supe... 65 6e-09 gb|PNT41316.1| hypothetical protein POPTR_004G149400v3 [Populus ... 65 6e-09 ref|XP_011037597.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 ref|XP_011037595.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 gb|OWM85031.1| hypothetical protein CDL15_Pgr027818 [Punica gran... 63 3e-08 ref|XP_020217302.1| pentatricopeptide repeat-containing protein ... 63 3e-08 gb|KDO51404.1| hypothetical protein CISIN_1g011075mg [Citrus sin... 63 3e-08 gb|PKI58053.1| hypothetical protein CRG98_021546 [Punica granatum] 63 3e-08 gb|KYP66036.1| Pentatricopeptide repeat-containing protein At2g1... 63 3e-08 dbj|GAY51898.1| hypothetical protein CUMW_137840 [Citrus unshiu] 63 3e-08 gb|KHN06157.1| Pentatricopeptide repeat-containing protein [Glyc... 62 4e-08 ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 dbj|GAV67115.1| PPR domain-containing protein/PPR_1 domain-conta... 62 4e-08 >ref|XP_023734289.1| pentatricopeptide repeat-containing protein At2g15980 [Lactuca sativa] gb|PLY97252.1| hypothetical protein LSAT_1X38361 [Lactuca sativa] Length = 483 Score = 67.8 bits (164), Expect = 5e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 M+EGMKLQAEM+GRG+EPNSGIYSAFI+GY K GN E A Sbjct: 434 MDEGMKLQAEMVGRGYEPNSGIYSAFINGYEKEGNKEQA 472 >ref|XP_021896778.1| pentatricopeptide repeat-containing protein At2g15980 [Carica papaya] ref|XP_021896780.1| pentatricopeptide repeat-containing protein At2g15980 [Carica papaya] ref|XP_021896781.1| pentatricopeptide repeat-containing protein At2g15980 [Carica papaya] ref|XP_021896782.1| pentatricopeptide repeat-containing protein At2g15980 [Carica papaya] ref|XP_021896783.1| pentatricopeptide repeat-containing protein At2g15980 [Carica papaya] Length = 503 Score = 67.0 bits (162), Expect = 9e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 M+E +KLQAEMMGRGFEPN IYSAFIDGYVK GN EMA Sbjct: 445 MDEALKLQAEMMGRGFEPNLVIYSAFIDGYVKQGNEEMA 483 >gb|PNY14751.1| hypothetical protein L195_g011436 [Trifolium pratense] Length = 188 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 M+EG+KLQAEM+G+GFEPNS IY AFIDGY++ GN E A Sbjct: 132 MDEGLKLQAEMVGKGFEPNSEIYEAFIDGYIRQGNHEKA 170 >dbj|GAU35854.1| hypothetical protein TSUD_63440 [Trifolium subterraneum] Length = 220 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 M+EG+KLQ EM+G+GFEPNS IY AFIDGY++ GN EMA Sbjct: 164 MDEGLKLQTEMVGKGFEPNSEIYEAFIDGYIRQGNDEMA 202 >gb|KVI07769.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 572 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 ME+GMKLQAEM+GRG+EPNS IY AFIDGY K GN E+A Sbjct: 521 MEDGMKLQAEMVGRGYEPNSEIYRAFIDGYEKEGNKELA 559 >ref|XP_022036423.1| pentatricopeptide repeat-containing protein At2g15980 [Helianthus annuus] ref|XP_022036424.1| pentatricopeptide repeat-containing protein At2g15980 [Helianthus annuus] Length = 485 Score = 64.7 bits (156), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMAG 120 MEE MK+QAEM+G+G+EPNS IYSAFI GY K GN+E+AG Sbjct: 436 MEESMKVQAEMVGKGYEPNSEIYSAFISGYEKEGNVELAG 475 >ref|XP_002306075.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gb|PNT41317.1| hypothetical protein POPTR_004G149400v3 [Populus trichocarpa] Length = 498 Score = 64.7 bits (156), Expect = 6e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +KLQ+EM+G+GF+PNS IY AFI+GYVK+GN EMA Sbjct: 439 MEEALKLQSEMVGKGFDPNSAIYGAFIEGYVKLGNEEMA 477 >gb|OTG30015.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 513 Score = 64.7 bits (156), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMAG 120 MEE MK+QAEM+G+G+EPNS IYSAFI GY K GN+E+AG Sbjct: 436 MEESMKVQAEMVGKGYEPNSEIYSAFISGYEKEGNVELAG 475 >gb|PNT41316.1| hypothetical protein POPTR_004G149400v3 [Populus trichocarpa] Length = 526 Score = 64.7 bits (156), Expect = 6e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +KLQ+EM+G+GF+PNS IY AFI+GYVK+GN EMA Sbjct: 467 MEEALKLQSEMVGKGFDPNSAIYGAFIEGYVKLGNEEMA 505 >ref|XP_011037597.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 isoform X2 [Populus euphratica] Length = 510 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +KLQ+EM+G+GF+PNS IY AFI+GYVK+GN EMA Sbjct: 451 MEEALKLQSEMVGKGFDPNSTIYGAFIEGYVKLGNEEMA 489 >ref|XP_011037595.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 isoform X1 [Populus euphratica] ref|XP_011037596.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 isoform X1 [Populus euphratica] Length = 524 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +KLQ+EM+G+GF+PNS IY AFI+GYVK+GN EMA Sbjct: 465 MEEALKLQSEMVGKGFDPNSTIYGAFIEGYVKLGNEEMA 503 >gb|OWM85031.1| hypothetical protein CDL15_Pgr027818 [Punica granatum] Length = 480 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 ME+ +KLQAEM+GRGF+PN +YSAF+DGY+K GN EMA Sbjct: 409 MEDALKLQAEMVGRGFQPNLQVYSAFVDGYMKRGNSEMA 447 >ref|XP_020217302.1| pentatricopeptide repeat-containing protein At2g15980 isoform X1 [Cajanus cajan] ref|XP_020217303.1| pentatricopeptide repeat-containing protein At2g15980 isoform X2 [Cajanus cajan] Length = 485 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMAG 120 MEE +K+QAEM+G+GF+PNS IY AFIDGY++ G EMAG Sbjct: 432 MEEALKVQAEMVGKGFQPNSEIYGAFIDGYIRQGKEEMAG 471 >gb|KDO51404.1| hypothetical protein CISIN_1g011075mg [Citrus sinensis] gb|KDO51405.1| hypothetical protein CISIN_1g011075mg [Citrus sinensis] Length = 494 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +K+QAEM+G+GFEP+ IYSAFIDGY+K GN+EMA Sbjct: 439 MEEALKVQAEMVGKGFEPSLEIYSAFIDGYMKEGNVEMA 477 >gb|PKI58053.1| hypothetical protein CRG98_021546 [Punica granatum] Length = 505 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 ME+ +KLQAEM+GRGF+PN +YSAF+DGY+K GN EMA Sbjct: 434 MEDALKLQAEMVGRGFQPNLQVYSAFVDGYMKRGNSEMA 472 >gb|KYP66036.1| Pentatricopeptide repeat-containing protein At2g15980 family [Cajanus cajan] Length = 561 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMAG 120 MEE +K+QAEM+G+GF+PNS IY AFIDGY++ G EMAG Sbjct: 384 MEEALKVQAEMVGKGFQPNSEIYGAFIDGYIRQGKEEMAG 423 >dbj|GAY51898.1| hypothetical protein CUMW_137840 [Citrus unshiu] Length = 573 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +K+QAEM+G+GFEP+ IYSAFIDGY+K GN+EMA Sbjct: 439 MEEALKVQAEMVGKGFEPSLEIYSAFIDGYMKEGNVEMA 477 >gb|KHN06157.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 486 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +K+QAEM+G+GF+PNS IY AF+DGYV+ GN EMA Sbjct: 434 MEEALKVQAEMVGKGFQPNSEIYGAFVDGYVRHGNEEMA 472 >ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Glycine max] gb|KRH29533.1| hypothetical protein GLYMA_11G122100 [Glycine max] Length = 487 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +K+QAEM+G+GF+PNS IY AF+DGYV+ GN EMA Sbjct: 435 MEEALKVQAEMVGKGFQPNSEIYGAFVDGYVRHGNEEMA 473 >dbj|GAV67115.1| PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 496 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 MEEGMKLQAEMMGRGFEPNSGIYSAFIDGYVKVGNMEMA 117 MEE +KLQAEM+G+GFEPN IY AF+DGY+K GN EMA Sbjct: 441 MEEALKLQAEMVGQGFEPNLEIYEAFVDGYLKEGNEEMA 479