BLASTX nr result
ID: Chrysanthemum21_contig00033671
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033671 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022038743.1| F-box/FBD/LRR-repeat protein At5g22660-like ... 58 6e-07 >ref|XP_022038743.1| F-box/FBD/LRR-repeat protein At5g22660-like [Helianthus annuus] gb|OTG25771.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 459 Score = 57.8 bits (138), Expect = 6e-07 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = -3 Query: 424 EKRRLVIASFLLEHGNVLEEIVFSWLSKVQYHEXXXXXXXXXXXXXXXXSTVKLISVLRE 245 EKR++ +A FLLEHGN LEE+VFSW KV YHE STVKLI++L++ Sbjct: 400 EKRKVDMARFLLEHGNELEEMVFSWRDKVNYHEKSTETMKEVSKFYKASSTVKLITLLKD 459