BLASTX nr result
ID: Chrysanthemum21_contig00033657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033657 (597 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY92624.1| hypothetical protein LSAT_2X85461 [Lactuca sativa] 64 3e-10 ref|XP_023754361.1| uncharacterized protein LOC111902779 [Lactuc... 62 4e-09 >gb|PLY92624.1| hypothetical protein LSAT_2X85461 [Lactuca sativa] Length = 77 Score = 63.9 bits (154), Expect = 3e-10 Identities = 39/71 (54%), Positives = 47/71 (66%) Frame = +3 Query: 138 ALVFMIMVVSVVSRNTPPSPLATTTIQNDSGHVKVSEITRLVINQVHRVERKVQAYYTAS 317 AL+ M+MV S VSRNTPP P ++ + G S++ V V RV KVQAYYTAS Sbjct: 11 ALILMVMVASSVSRNTPPPPPPSSP--SPPGTTTSSKVDDKVA-PVQRVG-KVQAYYTAS 66 Query: 318 SGPSDRGRGHK 350 SGPSD+GRGHK Sbjct: 67 SGPSDKGRGHK 77 >ref|XP_023754361.1| uncharacterized protein LOC111902779 [Lactuca sativa] Length = 107 Score = 62.0 bits (149), Expect = 4e-09 Identities = 38/70 (54%), Positives = 46/70 (65%) Frame = +3 Query: 138 ALVFMIMVVSVVSRNTPPSPLATTTIQNDSGHVKVSEITRLVINQVHRVERKVQAYYTAS 317 AL+ M+MV S VSRNTPP P ++ + G S++ V V RV KVQAYYTAS Sbjct: 11 ALILMVMVASSVSRNTPPPPPPSSP--SPPGTTTSSKVDDKVA-PVQRVG-KVQAYYTAS 66 Query: 318 SGPSDRGRGH 347 SGPSD+GRGH Sbjct: 67 SGPSDKGRGH 76