BLASTX nr result
ID: Chrysanthemum21_contig00033620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033620 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX95621.1| trehalose-6-phosphate synthase domain protein [Tr... 57 3e-06 emb|CDP15959.1| unnamed protein product [Coffea canephora] 57 3e-06 ref|XP_011021751.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 57 3e-06 ref|XP_022888986.1| alpha,alpha-trehalose-phosphate synthase [UD... 56 4e-06 emb|CDP05571.1| unnamed protein product [Coffea canephora] 56 4e-06 gb|OTF85284.1| putative glycosyl transferase, family 20 [Heliant... 56 4e-06 ref|XP_006378432.1| hypothetical protein POPTR_0010s11510g [Popu... 56 4e-06 ref|XP_015866939.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 4e-06 ref|XP_002312472.1| hypothetical protein POPTR_0008s13590g [Popu... 56 5e-06 ref|XP_019446204.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 ref|XP_018837914.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 ref|XP_021598240.1| alpha,alpha-trehalose-phosphate synthase [UD... 56 5e-06 ref|XP_015866937.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 ref|XP_011021750.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 ref|XP_002314777.2| hypothetical protein POPTR_0010s11510g [Popu... 56 5e-06 ref|XP_022846607.1| alpha,alpha-trehalose-phosphate synthase [UD... 56 5e-06 gb|PHT99280.1| Alpha,alpha-trehalose-phosphate synthase [UDP-for... 56 5e-06 ref|XP_016537449.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 ref|XP_015058328.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 ref|XP_006364054.1| PREDICTED: alpha,alpha-trehalose-phosphate s... 56 5e-06 >gb|PNX95621.1| trehalose-6-phosphate synthase domain protein [Trifolium pratense] Length = 766 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQHC 301 QAK++LDH +SVLANEPVTVKSGQN VEVK Q C Sbjct: 730 QAKELLDHLESVLANEPVTVKSGQNYVEVKPQVC 763 >emb|CDP15959.1| unnamed protein product [Coffea canephora] Length = 793 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQHC 301 QAK+MLDH +SVLANEPV+VKSGQ+IVEVK Q C Sbjct: 650 QAKEMLDHLESVLANEPVSVKSGQHIVEVKPQAC 683 >ref|XP_011021751.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 isoform X2 [Populus euphratica] Length = 832 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQH 304 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q+ Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQN 760 >ref|XP_022888986.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Olea europaea var. sylvestris] Length = 448 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 322 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 353 >emb|CDP05571.1| unnamed protein product [Coffea canephora] Length = 660 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 534 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 565 >gb|OTF85284.1| putative glycosyl transferase, family 20 [Helianthus annuus] Length = 701 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 563 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 594 >ref|XP_006378432.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa] gb|PNT15768.1| hypothetical protein POPTR_010G104500v3 [Populus trichocarpa] Length = 815 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_015866939.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like isoform X2 [Ziziphus jujuba] Length = 832 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 706 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 737 >ref|XP_002312472.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa] gb|PNT24480.1| hypothetical protein POPTR_008G136500v3 [Populus trichocarpa] Length = 851 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_019446204.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Lupinus angustifolius] gb|OIW10095.1| hypothetical protein TanjilG_21932 [Lupinus angustifolius] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_018837914.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Juglans regia] ref|XP_018837915.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Juglans regia] ref|XP_018837916.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Juglans regia] ref|XP_018837918.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Juglans regia] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_021598240.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Manihot esculenta] ref|XP_021598242.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Manihot esculenta] gb|OAY25329.1| hypothetical protein MANES_17G085400 [Manihot esculenta] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_015866937.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like isoform X1 [Ziziphus jujuba] ref|XP_015866938.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like isoform X1 [Ziziphus jujuba] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_011021750.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 isoform X1 [Populus euphratica] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_002314777.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa] gb|PNT15769.1| hypothetical protein POPTR_010G104500v3 [Populus trichocarpa] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 728 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 759 >ref|XP_022846607.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Olea europaea var. sylvestris] Length = 857 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 731 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 762 >gb|PHT99280.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum chinense] Length = 857 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 730 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 761 >ref|XP_016537449.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] ref|XP_016537450.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] ref|XP_016537451.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] gb|PHT60436.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum baccatum] gb|PHT73934.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Capsicum annuum] Length = 857 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 730 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 761 >ref|XP_015058328.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Solanum pennellii] ref|XP_015058336.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Solanum pennellii] Length = 857 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 730 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 761 >ref|XP_006364054.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Solanum tuberosum] ref|XP_015159238.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Solanum tuberosum] ref|XP_015159239.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6-like [Solanum tuberosum] Length = 857 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 402 QAKDMLDHQQSVLANEPVTVKSGQNIVEVKHQ 307 QAK++LDH +SVLANEPVTVKSGQNIVEVK Q Sbjct: 730 QAKELLDHLESVLANEPVTVKSGQNIVEVKPQ 761