BLASTX nr result
ID: Chrysanthemum21_contig00033499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033499 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88165.1| Ankyrin repeat-containing protein [Cynara cardunc... 62 7e-08 ref|XP_023732295.1| calmodulin-binding transcription activator 6... 61 2e-07 ref|XP_023765664.1| calmodulin-binding transcription activator 6... 61 2e-07 ref|XP_021898630.1| calmodulin-binding transcription activator 5... 59 1e-06 ref|XP_022038465.1| calmodulin-binding transcription activator 5... 57 4e-06 gb|KVH99848.1| Ankyrin repeat-containing domain-containing prote... 57 5e-06 dbj|GAV70877.1| IQ domain-containing protein/CG-1 domain-contain... 56 8e-06 >gb|KVH88165.1| Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 974 Score = 62.4 bits (150), Expect = 7e-08 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Frame = +1 Query: 229 RLKSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTAW---MT 399 R KS+A LL GANPNL TDPTS+N GG TPADLA K+GYE L++K A MT Sbjct: 669 RQKSVASLLSAGANPNLVTDPTSENPGGCTPADLASKSGYEGLAAFLAEKALLAHFEAMT 728 Query: 400 LA 405 LA Sbjct: 729 LA 730 >ref|XP_023732295.1| calmodulin-binding transcription activator 6-like [Lactuca sativa] ref|XP_023732296.1| calmodulin-binding transcription activator 6-like [Lactuca sativa] ref|XP_023732297.1| calmodulin-binding transcription activator 6-like [Lactuca sativa] ref|XP_023732298.1| calmodulin-binding transcription activator 6-like [Lactuca sativa] ref|XP_023732299.1| calmodulin-binding transcription activator 6-like [Lactuca sativa] gb|PLY75030.1| hypothetical protein LSAT_1X43941 [Lactuca sativa] Length = 863 Score = 60.8 bits (146), Expect = 2e-07 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +1 Query: 229 RLKSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTAW---MT 399 R + +A LL VGANPNL TDPTS+N G TPADLA KNGYE L++K A MT Sbjct: 559 RQRMVASLLSVGANPNLVTDPTSENPSGCTPADLASKNGYEGLAAYLAEKALVAHFEAMT 618 Query: 400 LA 405 LA Sbjct: 619 LA 620 >ref|XP_023765664.1| calmodulin-binding transcription activator 6-like [Lactuca sativa] gb|PLY84038.1| hypothetical protein LSAT_6X114260 [Lactuca sativa] Length = 864 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = +1 Query: 235 KSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTAW---MTLA 405 +++A LL GANPNL TDPTS+N GG TPADLA KNGYE L++K A MTLA Sbjct: 559 RTVASLLSAGANPNLVTDPTSENPGGCTPADLASKNGYEGLAAFLAEKALLAHFEAMTLA 618 >ref|XP_021898630.1| calmodulin-binding transcription activator 5 [Carica papaya] Length = 865 Score = 58.5 bits (140), Expect = 1e-06 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = +1 Query: 217 AIDNRLKSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTA 390 A R K +A LL GA PNL TDPTSKN GG T ADLA KNGY+ LS+K A Sbjct: 557 AFYGREKMVAVLLSAGAKPNLVTDPTSKNPGGSTAADLASKNGYDGLAAFLSEKALVA 614 >ref|XP_022038465.1| calmodulin-binding transcription activator 5-like [Helianthus annuus] gb|OTG25487.1| putative IQ motif, EF-hand binding site [Helianthus annuus] Length = 855 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +1 Query: 229 RLKSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTAW---MT 399 R + +A LL GANPNL TDPT N GG TPADLA K+GYE L++K A MT Sbjct: 550 RQRCVASLLSAGANPNLVTDPTPDNPGGSTPADLASKSGYEGLAAFLAEKALIAHFEAMT 609 Query: 400 LA 405 LA Sbjct: 610 LA 611 >gb|KVH99848.1| Ankyrin repeat-containing domain-containing protein [Cynara cardunculus var. scolymus] Length = 878 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = +1 Query: 235 KSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTAW---MTLA 405 + +A LL GANPNL TDPTS+N G TPADLA K+GYE L++K A MTLA Sbjct: 574 RMVASLLSAGANPNLVTDPTSENTNGCTPADLASKSGYEGLAAYLAEKSLVAHFEAMTLA 633 >dbj|GAV70877.1| IQ domain-containing protein/CG-1 domain-containing protein/Ank_2 domain-containing protein [Cephalotus follicularis] Length = 659 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/54 (59%), Positives = 34/54 (62%) Frame = +1 Query: 229 RLKSIAPLLFVGANPNLKTDPTSKNFGGHTPADLA*KNGYEVCQHVLSKKRCTA 390 R K +A LL GA PNL TDPTSKN G TPADLA NGYE LS+K A Sbjct: 361 REKMVAVLLSSGAKPNLVTDPTSKNPSGCTPADLAYMNGYEGLAAYLSEKALVA 414