BLASTX nr result
ID: Chrysanthemum21_contig00033482
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033482 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH89577.1| JmjC domain-containing protein [Cynara cardunculu... 55 3e-06 >gb|KVH89577.1| JmjC domain-containing protein [Cynara cardunculus var. scolymus] Length = 953 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 8/53 (15%) Frame = +2 Query: 20 LGESEADRSPRIEPKSLDEPVLPKSPIAAH--------DIDSVEEDRTESQGI 154 LGESE +SP P +L E +LPKSPIA H +DS+E+DRTESQGI Sbjct: 681 LGESEVAKSPEKAPDNLSEQMLPKSPIAEHSTKNDGEISLDSIEDDRTESQGI 733